(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE318

CP001994.PE318       Location/Qualifiers
FT   CDS_pept        344012..345022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0324"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; InterPro
FT                   IPR010067; KEGG: csa:Csal_0183 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein; SPTR: Q8TUK2 Sulfonate ABC
FT                   transporter, solute-binding protein; TIGRFAM: aliphatic
FT                   sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: NMT1/THI5 like; TIGRFAM: ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulfonates family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35856"
FT                   /db_xref="GOA:D5E9K5"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K5"
FT                   /protein_id="ADE35856.1"
FT                   /translation="MKKISKILFLILVVAGSVFLAGCASQDGDGTEEAADVTTLNIGYQ
FT                   PSTHQLSYMTAREKGWWEEDLASYGVEEVKEYEFPTGAPEMQAMLAGDLDVAYVGAAPF
FT                   ISALSNGLDAKVVAGVNSQGSDLVLRPEHSYEGPEDLKGLSIATFPPGTIQDTILRDWL
FT                   KDNGVDPDDDVDIKPMGPGDAISAISAGQIDAAFLPHPAPTLIEQEGNGRSVVYSGEML
FT                   PDHACCVLVVSGNLIRNHPEMVTEIVNTHIKATDYNLENQDEAAQIFAERQGWEVNVVR
FT                   TSIDEWDGQWIADPAIIADSTVDYAQVQYELGYVNEKFTREDIFDMSFYELAITE"
     atgaaaaaaa taagtaaaat actattcctc atacttgttg tggcaggttc tgtcttcctt        60
     gcaggctgtg cttctcagga tggagatggc acagaagagg cggcggacgt gaccactctt       120
     aacataggtt atcaacccag tacccatcag ctttcctata tgacagcaag ggaaaaagga       180
     tggtgggaag aggatcttgc ttcctatggt gtggaagaag tgaaagaata tgaatttccg       240
     accggtgctc ctgaaatgca ggcaatgctt gcaggagacc tggatgtggc ctatgtcggc       300
     gctgcaccat tcatatcagc cttgagtaac ggtcttgatg ccaaagtagt tgcaggcgtg       360
     aattcccagg gatccgatct tgtattgcgt cctgaacatt cctatgaagg tcctgaggat       420
     ctcaagggat tgagcatcgc aacgttcccg ccaggtacaa ttcaggatac aattctgcgt       480
     gactggttga aagataatgg tgtagatcct gatgatgatg ttgatataaa gccgatgggc       540
     cccggtgatg ccatctctgc aatttccgca ggccagattg atgctgcatt ccttccccac       600
     cctgctccaa cactgattga acaggaaggt aacggcaggt ctgttgtata ttccggtgaa       660
     atgctacctg accatgcatg ctgtgtgctt gttgtaagtg gaaacctgat acgcaatcat       720
     ccagaaatgg taaccgagat tgtaaatacc cacataaaag ccacagatta taatcttgaa       780
     aatcaggatg aagctgcaca gatatttgca gaaagacagg gatgggaagt taatgtggtc       840
     cgtacttcca ttgatgaatg ggatggccag tggattgctg accctgccat aattgcagat       900
     tccactgtgg attatgcaca ggtgcagtat gaacttggtt atgtcaatga aaagtttacc       960
     cgggaagaca tatttgatat gagcttctat gaactggcca taactgagta a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page