(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE323

CP001994.PE323       Location/Qualifiers
FT   CDS_pept        complement(347836..348534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0329"
FT                   /product="protein of unknown function DUF169"
FT                   /note="COGs: COG2043 conserved hypothetical protein;
FT                   InterPro IPR003748; KEGG: glo:Glov_0919 protein of unknown
FT                   function DUF169; PFAM: protein of unknown function DUF169;
FT                   SPTR: Q8PY80 Conserved protein; PFAM: Uncharacterised ArCR,
FT                   COG2043"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35861"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L0"
FT                   /protein_id="ADE35861.1"
FT                   /translation="MENKEISDKLKEILQLRYEPVAVKLVKRGEDVPANFNQPEKKTRH
FT                   CQSIMKARKGECLVIPADKHACVVGGSSLGLLETPDNVKSGEFHSKIGMFDTPQAAAKM
FT                   IEERAEFEECSMQATVVCPLAKADFKPDVVILIDLPETLYWIVPAFTFETGGRVTMSTA
FT                   PFQATCVDSTIIPIQTGDINYSMGCFGCRRTTDIGRDEMLVGIPGPILENIVEHLEELY
FT                   KKPIKKARGL"
     atggaaaata aagaaataag tgacaaactc aaggaaatac tgcaactaag atacgaacca        60
     gtagccgtga aattggttaa aaggggcgaa gatgttcctg caaactttaa ccaacccgag       120
     aaaaaaaccc gtcattgcca gtctatcatg aaggcaagga agggtgaatg tcttgtgata       180
     ccggcagata aacatgcatg cgtggtaggc ggttccagtc tgggactttt agaaacacca       240
     gacaatgtta aaagtggtga gttccactcc aaaatcggca tgttcgatac acctcaagca       300
     gctgctaaga tgatagagga gagagcggaa ttcgaggaat gcagcatgca ggcaacagtg       360
     gtttgtcctc ttgcaaaggc tgactttaaa cccgatgtgg tgattttgat cgatcttccc       420
     gaaacccttt actggattgt gccagcgttt acttttgaaa cgggaggaag ggtaaccatg       480
     agcacagcac cattccaggc cacctgcgta gattcaacta taattcccat ccagaccgga       540
     gatataaatt actccatggg atgtttcgga tgtcgcagga caaccgatat aggcagggat       600
     gaaatgcttg tgggaatacc aggcccaatt cttgaaaata tagtagagca tcttgaagaa       660
     ctctataaaa aacctatcaa gaaagccagg ggattgtaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page