(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE324

CP001994.PE324       Location/Qualifiers
FT   CDS_pept        complement(348569..349402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0330"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591:IPR002586:IPR000808; KEGG:
FT                   sat:SYN_00081 iron-sulfur cluster assembly/repair protein;
FT                   PFAM: ATPase-like, ParA/MinD; Cobyrinic acid ac-diamide
FT                   synthase; SPTR: Q12U65 ATP-binding protein involved in
FT                   chromosome partitioning; PFAM: ParA/MinD ATPase like;
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35862"
FT                   /db_xref="GOA:D5E9L1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L1"
FT                   /protein_id="ADE35862.1"
FT                   /translation="MSQNIQSAESLVNSKVEEPKIVSNLRGIRNKLMVMSGKGGVGKST
FT                   VSANLAAALARRGKKVGLLDSDIHGPSIPTMFGIADQRPEVGEKGILPVQVADNLKVMS
FT                   IGLLLDDPDSPVVWRGPAKMGAIKQFLEEVDWGVLDYLIIDLPPGTGDEPLSIVQLLGR
FT                   VDGAIVVTTPQDVALTSVRKSLKFAEMLEVPVIGMVENMSGVICPHCNEEIQVFGGESV
FT                   EKAAKDFNTPILATLPIEPDVSSTGDKGDVYVNDDKSIWKEKFDSIVSSVEEKFN"
     atgagtcaaa atatacagtc agctgaaagt ctggtaaatt ccaaagttga agaaccaaaa        60
     attgtatcga atctgcgtgg aataagaaac aagctcatgg tcatgagtgg caaaggcggt       120
     gtaggaaaga gtaccgtttc tgcaaaccta gctgcagccc ttgccaggcg cgggaaaaag       180
     gtagggctgc ttgacagtga tattcatgga ccaagtattc ccacaatgtt tggtatcgca       240
     gaccagagac ctgaagtagg agaaaaaggt attctgcctg tacaggttgc agataacctc       300
     aaggtcatgt ccataggttt attgctggac gatccggatt cccccgtggt ctggagagga       360
     cccgccaaga tgggtgccat aaaacagttc cttgaagaag ttgactgggg agtactggac       420
     tacctgatca tagacctgcc tccgggcaca ggagatgaac cattaagcat agtacagttg       480
     ctgggcaggg tcgatggtgc catcgttgtc acaacccccc aggacgtagc acttacaagt       540
     gtcaggaaat ccctgaaatt tgcagaaatg ctggaagtac ctgttatcgg aatggtcgaa       600
     aacatgagcg gtgtaatctg cccccactgc aatgaagaga tacaggtctt cggcggtgaa       660
     tctgtagaaa aggctgcaaa agatttcaac acccccatac ttgccacatt gcctatcgaa       720
     cccgatgttt catcaacagg agacaaagga gatgtatatg tcaatgacga taaatccatc       780
     tggaaagaaa aattcgattc aatcgttagt tctgtggaag aaaagttcaa ctaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page