(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE325

CP001994.PE325       Location/Qualifiers
FT   CDS_pept        complement(349417..349722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0331"
FT                   /product="protein of unknown function DUF134"
FT                   /note="COGs: COG1342 DNA-binding protein; InterPro
FT                   IPR002852; KEGG: ppr:PBPRA3114 hypothetical protein; PFAM:
FT                   protein of unknown function DUF134; SPTR: Q8TIB0 UPF0251
FT                   protein MA_4245; PFAM: Protein of unknown function DUF134"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35863"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L2"
FT                   /protein_id="ADE35863.1"
FT                   /translation="MKCRRGRPKCPRRIRAEPTIMCFKPCGIPRSEVEVVELAFEELEA
FT                   IRLVDVDELTQEEAALEMGISRRAFWEELKNARKKVARALVEGQAIDIKGGNYTTE"
     atgaaatgca ggagaggaag accaaaatgc ccccgcagga tacgggcaga gcccactatt        60
     atgtgcttta aaccctgcgg gataccaagg tctgaagttg aggtagtaga actcgcattt       120
     gaggaactgg aagccatccg acttgtggat gtggatgagc tgacacagga agaagctgcc       180
     cttgagatgg gaatttccag aagagctttc tgggaagaac tgaaaaatgc gagaaaaaaa       240
     gtcgccagag ctcttgttga aggacaggcc atcgatatca aaggcggaaa ttacactact       300
     gaataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page