(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE326

CP001994.PE326       Location/Qualifiers
FT   CDS_pept        349835..350950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0332"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003593:IPR014277; KEGG: similar to
FT                   AGAP005176-PA; K02213 cell division control protein 6;
FT                   SMART: AAA ATPase; SPTR: Q12U63 ORC complex protein
FT                   Cdc6/Orc1; TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); CDC6, C terminal; TIGRFAM:
FT                   orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35864"
FT                   /db_xref="GOA:D5E9L3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L3"
FT                   /protein_id="ADE35864.1"
FT                   /translation="MKNNMLLWDETIFRDPTVLELDYLPEQFMHRDSQLQSLIYSLKPA
FT                   VKGMRPINCLVYGPPGTGKTSAVLKVFEEIETHTSDVVLVKINCQMDSTRFAVVSRIYR
FT                   KLFNIDPPSSGVAFRKLFEKIVLKLIEKDKVMVVCLDDINYLFHGGHADEIMYSILRAH
FT                   EQYPGVKMGVIAIVSDTGKLYRFDPKVSSVFLPEEIEFPSYSYDEVGDIISSRIQLAFY
FT                   PEVVPEEVREKIVNYVDLTGDLRVGIDLLKRSGLNAEKRASKNISEDDVDKAYESSRLL
FT                   HLRRNISSLSDNEKEILRLVAENDEIKAGELYELFTGNNELGYTRFYGLVNKLKDSHYL
FT                   DVSFSGEGMRGRTRIIRLNYPADDVIKCIRG"
     atgaaaaata atatgcttct ctgggatgag acaattttca gggatcccac cgtactggag        60
     ctggattatc ttcccgaaca atttatgcac cgggattccc agctacaatc tctcatctat       120
     agtttaaagc ctgcagtaaa aggtatgaga cctattaatt gtcttgtata tggtccgccc       180
     ggcaccggta aaaccagtgc tgtattaaag gtttttgaag aaatagaaac acatacatcg       240
     gatgtggttc tggttaagat caattgccag atggattcca ctcgctttgc tgttgtttca       300
     cgcatatatc gcaaactttt caatatagat cctccgtctt cgggggtagc cttcaggaaa       360
     ctttttgaaa agattgtact gaaacttatc gaaaaggaca aggtaatggt ggtgtgtctg       420
     gatgatatca attatttatt ccacggagga catgccgatg agatcatgta ttccatatta       480
     cgggcccatg aacagtatcc cggtgtgaaa atgggtgtta ttgcgattgt aagtgatacg       540
     ggaaaacttt acaggtttga tccaaaggtg agttctgtat tcctgccaga agagattgaa       600
     tttccttctt attcttatga tgaagtagga gacatcattt cttccagaat ccagctggct       660
     ttttatccgg aggtagtgcc ggaggaagtc agggaaaaaa tagtgaatta tgtcgatttg       720
     accggtgatc tgcgtgttgg tatcgatcta ctcaagagat caggcctgaa tgcagaaaaa       780
     agggcaagca aaaacatttc agaggacgat gtggataagg cctatgaatc atcacgtctt       840
     ttgcatctga ggcgtaacat atcatccctt tcagataatg aaaaagagat cctgcggctt       900
     gtggcggaaa atgatgaaat caaagcaggc gaactttacg aactttttac gggcaataat       960
     gaattgggat atacccggtt ttatgggttg gtgaataaat tgaaggattc gcattatctg      1020
     gatgtttcgt tttcgggtga aggtatgcgg ggcagaaccc gtattattcg tctgaattat      1080
     cctgcagatg atgtaataaa atgtattcgg ggttga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page