(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE331

CP001994.PE331       Location/Qualifiers
FT   CDS_pept        complement(354453..355349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0337"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210; KEGG: aeh:Mlg_0734 response regulator receiver
FT                   protein; PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SPTR: Q8TNY0 Glycine
FT                   betaine/L-proline ABC transporter, solute-binding protein;
FT                   PFAM: Substrate binding domain of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35869"
FT                   /db_xref="GOA:D5E9L8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L8"
FT                   /protein_id="ADE35869.1"
FT                   /translation="MKYKLLKILACLIVAIALIGAGCTSQSDETPSEETTEEPVRIGVV
FT                   QWDDSRATGNVFLHILDEGGYEYETVSADLGGLYQATSQGDIDVLIQAWLPATQASYWD
FT                   QYGDSLNKAQVVSSGAKIGLAVPDYVYDSGITTVEDLKGNASKFDGKITGIEPGAGIMV
FT                   TTEQALEEYNLEEYELYSSSTVGMATTLQDNLDNEEWIVATLWRPHWTFARMEGLQFLE
FT                   DPKGIYGGSDNLVILTRPGFEEDRPEFYQLIQNYEMDLNDIESIMIAIDEGQSPEEAAS
FT                   DWLTENPEKYDEVLGTQ"
     ttgaaatata agcttttgaa aatattagca tgccttatag tggcaatcgc tttaatcggt        60
     gcaggttgca catcccagag cgatgaaact cctagtgaag agactacaga agagccagta       120
     cgaattggag tagtccagtg ggacgactca cgtgcaactg gaaatgtatt tctgcatatc       180
     cttgatgaag gaggctatga atacgaaact gtatccgcag atttaggagg tctataccag       240
     gcaacctcac agggagacat tgatgtcctt atccaagcat ggttacctgc aacccaggct       300
     tcatactggg atcaatacgg agacagtctg aacaaagcac aagtcgtgtc ctcaggtgct       360
     aaaattggac ttgctgttcc agactacgta tatgattccg gaattaccac cgtggaagac       420
     ctgaaaggca atgccagcaa attcgatggc aaaatcactg gtattgaacc cggtgcagga       480
     ataatggtca ccacagagca ggccctcgag gaatataacc ttgaagaata tgaattatat       540
     tccagcagta ctgtgggaat ggccacaaca cttcaggata accttgacaa tgaggaatgg       600
     atcgtagcta ccctctggag gccacactgg acattcgcac gtatggaagg cctgcaattc       660
     cttgaagatc caaagggaat atatggagga agtgacaacc ttgtcatcct cacaagaccc       720
     ggttttgaag aggacagacc agagttctac cagcttatcc agaactatga aatggatctt       780
     aatgatatcg aatcaataat gatcgctatc gatgaaggcc aatctcctga agaggctgca       840
     tctgactggc ttaccgagaa tcctgaaaag tacgatgaag tacttggaac ccagtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page