(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE333

CP001994.PE333       Location/Qualifiers
FT   CDS_pept        complement(356369..357199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0339"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4176 ABC-type proline/glycine betaine
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: dol:Dole_2764 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q2KP09 Transmembrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35871"
FT                   /db_xref="GOA:D5E9M0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M0"
FT                   /protein_id="ADE35871.1"
FT                   /translation="MIVPQLPLGSVVEAAVYWISDTFGFALDAFSGVFKFFIDIFKDVL
FT                   MAMPPLLFVVLLAVLAYVIGRKDWKLALGTALGFIVILSMDLWEYSMETIALVISSAAL
FT                   ALIIGIPLGILAAKSETLYRILRPILDLMQTMPSFVYLIPAVIFFGLGNVPGMIATVVF
FT                   SMPPAIRLTTLGITQVPTELVEVADAFGSTSWQKLIKVEIPVALKTIMAGVNQCIMLAL
FT                   SMVVIASMIGARGLGYQVLIGIQRVDIGLGFEAGLGIVIIAIVLDRLTQHLTPK"
     atgatagtac cacagttgcc gttaggcagt gttgtcgaag ctgcagtcta ctggattagt        60
     gatacttttg gctttgccct tgatgcattc agcggcgtct ttaaattttt tatagatatt       120
     ttcaaagacg tactgatggc aatgccacct ctgttgtttg ttgtgttgct agcagtcctt       180
     gcatacgtaa tcggtcgcaa ggactggaag cttgctttgg gtactgccct tggattcata       240
     gtaatactga gtatggatct ctgggaatac tccatggaga ccattgctct tgtaatttcg       300
     tctgctgcac tggctctaat aataggtatt ccgctgggca tacttgcggc aaagagtgag       360
     actctttaca ggatacttag accgattctg gaccttatgc agacaatgcc ttcctttgtt       420
     tatcttatcc cggcagttat cttctttgga cttggtaacg tgccaggtat gattgcaacc       480
     gttgtcttct caatgccccc tgcaatcagg cttacaaccc ttggaatcac ccaggttcct       540
     acagaacttg tggaagttgc cgacgctttt gggtcaacct catggcaaaa acttatcaag       600
     gtggaaatac ctgtagcttt aaagaccata atggccggtg taaaccaatg tataatgctt       660
     gccctttcaa tggtcgttat tgcctcaatg atcggagccc gaggccttgg ataccaggtt       720
     ttgataggaa tccagagagt tgatatagga cttggattcg aagcagggct tggaattgtc       780
     ataatcgcta ttgtacttga caggcttaca cagcacctta ccccaaaata a                831
//

If you have problems or comments...

PBIL Back to PBIL home page