(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE334

CP001994.PE334       Location/Qualifiers
FT   CDS_pept        complement(357196..358344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0340"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.32"
FT                   /note="COGs: COG4175 ABC-type proline/glycine betaine
FT                   transport system ATPase component;
FT                   InterProIPR000644:IPR003439:IPR003593:IPR017871:IPR 005892;
FT                   KEGG: mxa:MXAN_2249 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; CBS domain containing protein; SMART: AAA ATPase;
FT                   CBS domain containing protein; SPTR: Q2KP07 ATP-binding
FT                   protein; TIGRFAM: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter; CBS
FT                   domain; TIGRFAM: glycine betaine/L-proline transport ATP
FT                   binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35872"
FT                   /db_xref="GOA:D5E9M1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M1"
FT                   /protein_id="ADE35872.1"
FT                   /translation="MSYVEEGLSKDEIFNKTGQTVGLYNVSFDVYEGEIFVLMGLSGSG
FT                   KSTLLRCLNRLIEPTSGSITISDEDVTKASSERLRLIREKQISMVFQNFALLPHRTIID
FT                   NVAYGLEIQDFSKDERHEKAAVAIETVGLKGHEFSKPSQLSGGMQQRVGLARALATDPE
FT                   ILLMDEAFSALDPLIRSEMQDELLELEEKMQKTIVFVSHDLDEALKLGDRIALMKDGEI
FT                   AQIGTAEEILTNPANDYVSKFVAGVDKTKILTAENIMKRPDPVVSFKSGLQVALKLMEK
FT                   HGISSIYVVDKAKRLQGFLKADDAVRAQKAGKTMEDVIIKEFPKTTLDTPLQDLISIRA
FT                   ETDQPIAIVNENDKLVGVVVRGSILAALKTTEDEEQVEEAEQ"
     ttgtcctatg ttgaagaagg tctttcaaaa gatgaaatct tcaacaagac tggccagaca        60
     gtaggcctgt ataatgttag ttttgacgtg tatgaaggag aaatttttgt actcatgggc       120
     ctttccggtt ccggtaaatc aacccttttg cgttgtctga accggcttat tgaacccaca       180
     tccggatcaa taactattag cgatgaggat gttacaaagg catccagtga aagactcagg       240
     ctgatcaggg aaaagcagat cagtatggtc ttccagaatt tcgctctttt gccacacaga       300
     actatcattg ataatgttgc ctacggtctt gaaatacagg atttctcaaa ggatgagaga       360
     catgaaaagg cagcagttgc aatcgaaact gttggactga aaggtcatga gttcagcaaa       420
     ccatcccagt tgagcggagg tatgcagcag agggtaggac ttgcgagagc ccttgcaaca       480
     gacccggaga tactcttaat ggatgaagct ttcagcgccc ttgacccact tatccgcagt       540
     gagatgcagg atgagttgct ggaacttgag gaaaagatgc agaaaaccat tgtttttgta       600
     tcacatgatc tggatgaagc cctcaaactc ggtgaccgta ttgccctgat gaaagatgga       660
     gaaattgccc agatcgggac cgctgaagaa attcttacaa accctgcgaa tgattatgtc       720
     tcaaagttcg ttgcaggtgt ggataagaca aagattctta ccgctgagaa tataatgaag       780
     agacccgacc cggttgtatc attcaaatcc ggtctacaag tcgccctcaa actcatggaa       840
     aagcatggca tatcctccat atacgtggta gataaagcca agcgtcttca gggattcctg       900
     aaagctgatg atgcagtgcg agcacagaaa gccggaaaaa ccatggaaga tgtcatcata       960
     aaggagttcc cgaaaactac actcgatact ccgcttcaag accttatatc aatccgggcg      1020
     gaaacagatc agccaattgc gattgttaat gaaaatgata aacttgtagg cgtggttgtc      1080
     agaggcagta ttcttgctgc acttaagacc actgaagatg aagaacaagt tgaggaggca      1140
     gaacaatga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page