(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE342

CP001994.PE342       Location/Qualifiers
FT   CDS_pept        complement(365120..365554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0348"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="COGs: COG1931 conserved hypothetical protein;
FT                   InterPro IPR002739; PFAM: Protein of unknown function
FT                   DUF54; SPTR: Q12U54 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35880"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M9"
FT                   /protein_id="ADE35880.1"
FT                   /translation="MASVKLWACVNPTEDASKVCEGLTRISGLAPRLDDNIAVIDCNHR
FT                   DLQIFHHLLRDEEILDTARSVLEKGIHSPEEKISFMLNKQVAFVGRISFPAGEEELGSI
FT                   HVEIQCNGGELEDIINWLAPPTEEGKPVYEKDMPPLREGE"
     atggccagcg ttaagttatg ggcctgtgta aatccaacag aggatgcctc aaaggtatgt        60
     gagggcctta caaggattag tggtcttgca ccccgtttag atgataatat cgcagttata       120
     gattgcaacc atcgtgacct gcaaatcttc caccacctgc tgagggatga agaaattctc       180
     gatactgcaa ggtccgttct cgaaaaagga atacacagcc cggaagaaaa aataagtttc       240
     atgctcaata aacaggttgc ttttgtggga cgcattagtt tccctgcagg agaagaagaa       300
     ctcgggtcga tccacgtgga aattcaatgc aatggaggag aactggaaga cataataaac       360
     tggttagcac cccccacaga agaaggaaaa cctgtctatg aaaaggatat gcctccatta       420
     agagaaggtg agtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page