(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE344

CP001994.PE344       Location/Qualifiers
FT   CDS_pept        366161..367114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0350"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="COGs: COG0042 tRNA-dihydrouridine synthase; InterPro
FT                   IPR001269:IPR018517:IPR004652; KEGG: hsm:HSM_1609 nifR3
FT                   family TIM-barrel protein; PFAM: dihydrouridine synthase
FT                   DuS; SPTR: Q12U52 Dihydrouridine synthase, DuS; TIGRFAM:
FT                   TIM-barrel protein, nifR3 family; PFAM: Dihydrouridine
FT                   synthase (Dus); TIGRFAM: putative TIM-barrel protein, nifR3
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35882"
FT                   /db_xref="GOA:D5E9N1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N1"
FT                   /protein_id="ADE35882.1"
FT                   /translation="MRIGKVRLGGNLLLAPMAEVTNLAYRVVCRRRGASFAFTEMVNSE
FT                   AILHGNRKSYQMASSCADEGIFGIQIFGNSPVSMAKAAGILENTKFPSIIDINAGCPSP
FT                   RIRKTGAGSMLMEKPDVLENIVRCVVESVTVPVTVKIRVFRDVSQTVELASRLENAGAS
FT                   AITVHGRTATQQYSGLADHLYARRIKEELSIPVIANGDIRNGAFAAQLLEYTGCDGLMI
FT                   GRAAMGDPDVFLRIETFLENGTEFPSADCDQRKNRLEEYLKLLESYGLEKNVNLAAHSA
FT                   WFTRGLAGSRSFRKSIQNVKNSDGIISRMEVLCSES"
     atgcgaatcg gaaaggtaag acttggggga aacctcctgc ttgctccaat ggcagaggtg        60
     acaaatcttg cctaccgggt agtttgcagg cgcagggggg catcctttgc ctttaccgag       120
     atggttaatt ccgaagccat cctgcatggc aatagaaaat cgtatcagat ggcatcaagc       180
     tgtgcagatg aaggtatatt cggtatccag atatttggta attccccggt ctctatggca       240
     aaagcagcag gtatacttga aaatacaaaa ttcccctcta ttatagatat taatgcggga       300
     tgcccgtctc ccagaatccg taaaacgggt gcaggttcaa tgctcatgga aaaacctgat       360
     gtgctggaaa atattgtgcg ttgcgtggtg gagtcagtaa ctgtgccggt tactgtaaag       420
     atacgcgtat tcagggatgt gtcacagact gtagaactcg catcaagact ggaaaacgcc       480
     ggtgcctcag ccataacagt ccatggaagg actgccaccc agcaatattc ggggttggcg       540
     gatcatttgt acgctcgcag gattaaagag gagttatcaa ttcctgttat tgcaaacggg       600
     gatatccgga atggtgcttt tgctgcccag ctccttgaat atacaggatg tgacggtctt       660
     atgatagggc gggccgcaat gggggatcct gatgtctttt taaggataga gacattcctt       720
     gaaaacggca cagagtttcc ttctgctgat tgtgatcagc gaaaaaaccg tctggaggaa       780
     tacctgaaac tgctggaatc gtatgggttg gagaaaaacg ttaacctggc agcacattcc       840
     gcctggttta ccaggggtct tgcaggttcc aggtcatttc gcaaatccat ccagaatgta       900
     aaaaatagtg atggtattat ttccaggatg gaagtgctat gtagcgagtc ataa             954
//

If you have problems or comments...

PBIL Back to PBIL home page