(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE346

CP001994.PE346       Location/Qualifiers
FT   CDS_pept        367856..368116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0352"
FT                   /product="pyruvate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR001080:IPR001450:IPR017900:IPR011898; KEGG:
FT                   ppd:Ppro_0323 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q2Y4G5 Pyruvate
FT                   synthase, delta subunit; TIGRFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, delta subunit; PFAM:
FT                   4Fe-4S binding domain; TIGRFAM: 2-oxoacid:acceptor
FT                   oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35884"
FT                   /db_xref="GOA:D5E9N3"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N3"
FT                   /protein_id="ADE35884.1"
FT                   /translation="MSIPLGGVCEPGTTRLNKTGGWRTFRPVYDYDKCIKCKLCELLCP
FT                   DMAVLPRDDGFFEFDYDYCKGCGICANECPTEAIDMVLEEK"
     atgagcattc cacttggagg agtctgtgaa ccaggtacta cgaggttaaa caagaccggt        60
     ggctggagga ctttcaggcc agtctatgac tacgataaat gtatcaaatg taaattatgt       120
     gaattgctct gtcccgacat ggcggtacta cccagggacg acgggttctt tgaatttgat       180
     tacgactact gcaaaggatg tggaatctgt gccaatgaat gtcccacgga agccattgat       240
     atggtactgg aggaaaaata a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page