(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE347

CP001994.PE347       Location/Qualifiers
FT   CDS_pept        368117..369331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0353"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR005476:IPR002880; KEGG: lch:Lcho_2150 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; Transketolase domain
FT                   protein; SPTR: Q2Y4G6 Pyruvate synthase, alpha subunit;
FT                   PFAM: domain; Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35885"
FT                   /db_xref="GOA:D5E9N4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N4"
FT                   /protein_id="ADE35885.1"
FT                   /translation="MTVIRTLEKDKMDVAEGSYAVAHAVKVCRPNIISAYPITPQTHIV
FT                   EDLSQFMADGEIPNCEYINVESEFSALSALVGSAAAGARCYSATTSQGLELMHEVLFNV
FT                   SGMRLPVVMTIANRAVSAPINIWNDHQDSISQRDTGWIQMYAEDLQEISDMTAQAYRVA
FT                   EDKDVMMPAMTCMDGFILSHVYEPVVLLEQDLVDEYLPAFEPEYTLDPKNPLTFGAFAD
FT                   PSAYTEFRYLQQQAMDNALPKIEEAANEFYEIFGRYYGGLIDEYETEDADIILMAMGSL
FT                   VGTIRDVVDKLRAKGVKVGLLKVRTFRPFPAEAIKNVIKDAKVVVALDKNISLGLNEGS
FT                   LFTETKASLYNTKVDVPIVGRMLGHGGRDIPVKTIEDIVEEAKGIISSGINTESKYADL
FT                   KEELL"
     atgacagtta tacgtaccct tgaaaaggat aagatggatg tggccgaagg ttcctatgca        60
     gtggctcatg ctgtgaaggt atgcaggcca aatattattt ccgcatatcc tatcacacca       120
     cagacccata ttgtggagga cctttcccag tttatggccg atggtgagat tcccaactgt       180
     gaatatataa acgtggaatc cgagttctcc gccctttcag ccctagtggg atccgcagca       240
     gcaggtgcac ggtgttattc agccaccacc tcacagggtc tggaactgat gcacgaggtt       300
     cttttcaatg tgtcagggat gcgcctgcca gttgtaatga ccatagcaaa tcgtgcggtc       360
     agtgccccta tcaacatctg gaacgatcat caggattcca tttcccagcg tgataccggc       420
     tggatccaga tgtatgctga ggacctgcag gaaatttcgg atatgaccgc ccaggcttac       480
     agggttgcag aagataagga tgtaatgatg cctgcaatga cctgtatgga tggtttcatc       540
     ctgtctcatg tttatgagcc cgtggtattg ctggaacagg atcttgtgga tgaatatctg       600
     cctgcttttg aaccggaata tacactcgat cctaaaaacc cgctgacctt cggtgccttt       660
     gcagatccga gtgcatatac ggaattcagg tatctgcagc aacaggcaat ggataatgca       720
     ctacccaaaa tagaagaagc tgccaatgag ttctatgaga tatttggaag gtactatggt       780
     ggcctgattg atgaatatga gacagaagat gctgacatca tactcatggc tatgggttca       840
     cttgtgggaa ccatcaggga tgtcgtggat aaactccgtg cgaaaggagt caaggttggt       900
     ttgcttaaag taaggacttt caggccattc ccggcagaag caataaagaa tgttatcaag       960
     gatgccaaag tcgttgtcgc acttgacaag aacatctctt taggactcaa tgaaggttct      1020
     ctctttaccg agaccaaggc aagcctgtat aatactaagg ttgatgtccc gatagtgggc      1080
     aggatgcttg gccacggtgg tcgtgacatt cccgtaaaaa ccattgagga cattgtagag      1140
     gaagccaaag gcataatctc ttcgggtatc aatactgaga gcaaatatgc tgatctgaag      1200
     gaggaattgt tgtga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page