(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE349

CP001994.PE349       Location/Qualifiers
FT   CDS_pept        370231..370869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0355"
FT                   /product="endonuclease III; DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="COGs: COG0177 EndoIII-related endonuclease;
FT                   InterProIPR003265:IPR003651:IPR004035:IPR004036:IPR 005759;
FT                   KEGG: scl:sce4746 putative endonuclease III; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; PRIAM:
FT                   DNA-(apurinic or apyrimidinic site) lyase; SMART: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; SPTR: Q8PYG7
FT                   Endonuclease III; TIGRFAM: endonuclease III; PFAM: HhH-GPD
FT                   superfamily base excision DNA repair protein; Iron-sulfur
FT                   binding domain of endonuclease III; Helix-hairpin-helix
FT                   motif; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35887"
FT                   /db_xref="GOA:D5E9N6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N6"
FT                   /protein_id="ADE35887.1"
FT                   /translation="MTANNLSNFPQIWGLLKKEYPDPQPALHFKTPLQLLVATILSAQS
FT                   TDVQINKVTRELFRKYRSVFDYADADISELEKDIYSTGFYRNKAKHLQQSARVIIEDFD
FT                   GEVPSTMEDLLKLPGVARKTANIVLARGFGVKAGIAVDTHVKRLATRLGFTVNKDPVKI
FT                   ERDLMELVDRNEWDDFSLTLILHGRNICFARKPACGKCVVNHLCPSSLV"
     atgacagcaa acaatctttc taatttccct caaatatggg gacttcttaa aaaagaatat        60
     cctgatcccc aacctgctct gcatttcaaa accccgctcc aactgcttgt agccactatc       120
     ctgtcggccc agagtacgga tgtgcagatc aataaagtca cacgtgagtt gttcaggaaa       180
     taccgttcgg tctttgatta tgcggatgcg gacatcagtg aactggaaaa ggatatctat       240
     tccacaggtt tttaccgcaa caaggccaaa cacctgcaac agagtgccag agttattatc       300
     gaggactttg atggtgaagt tccgtccacg atggaagacc tgttaaaact ccccggggtg       360
     gcccgcaaga ccgctaatat agtgcttgca agaggttttg gtgtaaaagc gggaattgct       420
     gtggacactc atgtcaaacg tcttgctaca cgcctgggtt ttactgtaaa taaggatcct       480
     gtcaaaattg aacgggatct gatggagctt gttgacagga atgaatggga cgatttttcc       540
     ctgacattga tattacatgg caggaacata tgttttgccc gcaagcccgc ctgtgggaaa       600
     tgtgttgtaa atcacctctg cccctcgagt ttggtttga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page