(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE350

CP001994.PE350       Location/Qualifiers
FT   CDS_pept        370978..372069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0356"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair; InterPro IPR001126:IPR017963; KEGG:
FT                   sat:SYN_02012 DNA polymerase IV; PFAM: UMUC domain protein
FT                   DNA-repair protein; PRIAM: DNA-directed DNA polymerase;
FT                   SPTR: Q8TIW3 DNA polymerase IV; PFAM: impB/mucB/samB family
FT                   C-terminal; impB/mucB/samB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35888"
FT                   /db_xref="GOA:D5E9N7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N7"
FT                   /protein_id="ADE35888.1"
FT                   /translation="MSRIVVHVDMDYFYAAVEEREDPSLRGRSVVVCMYSGRGEHRGSV
FT                   STSNYTARKYGIKSGMPCSRAIKLNQDAVFLPVRKEFYTEVSDSIMEVLRSHADSDESF
FT                   EQISIDEAFIEVTANCNDDFECALKLGEDIKQKILEKEQLTCSVGIGPNKLIAKMASSE
FT                   NKPNGITVISQHDVKPFLEDRTPSQLWGVGDVTAGRLEQMGIKKVGQLASSDIVSLTDA
FT                   FGKKKGSWLKKAAQGMDESPVRQREGSEQIGRIATLPENSSEYDLIMPVLDNLADDVIR
FT                   KTIERGVSFRQVTLIVITSDFKTQTRNHTLQRAVAEKEILRSNLDKLLTTFLEENKSAI
FT                   RRIGVRVAGLQEVSSQTTLASYF"
     atgtcacgta ttgttgtcca cgtagacatg gactacttct atgctgctgt cgaggagcgt        60
     gaagaccctt ctcttagggg caggtctgta gtggtctgca tgtattcggg tagaggggag       120
     cacagaggct cggtaagtac ttccaattat acagcccgca aatatggtat aaaatccggt       180
     atgccatgtt ccagagccat taaactgaat caggatgctg tttttcttcc tgtaagaaaa       240
     gagttttaca ctgaagtttc tgacagtatc atggaagtac tgcgctctca tgcggatagt       300
     gatgaatctt ttgagcagat aagtatagat gaggcattca tcgaagttac ggcaaactgt       360
     aacgatgatt ttgaatgtgc ccttaaattg ggtgaagata ttaaacaaaa gattctggaa       420
     aaagaacagc tgacctgttc tgtggggatt ggccccaaca aactcattgc taaaatggca       480
     tcctcggaaa ataaacccaa tggaattact gtcatttcac aacatgatgt aaaaccattt       540
     ctggaagatc ggactccttc tcaactctgg ggtgtggggg atgtcacagc cggcaggctt       600
     gaacagatgg gcataaaaaa agtggggcaa cttgcttctt cggatattgt gtctcttaca       660
     gatgcttttg gtaaaaagaa aggctcatgg ctcaaaaaag cggcacaggg gatggatgag       720
     tctcctgtca ggcagcggga aggcagtgag caaattggaa ggatagccac tttaccggaa       780
     aattcatcgg agtatgatct gataatgcca gttctggata accttgccga tgatgtgatc       840
     agaaagacca ttgaaagagg cgtttctttc cgtcaggtta cactgatcgt aatcacatct       900
     gatttcaaaa cccaaactcg taatcatacc cttcagaggg cggttgctga gaaagaaatt       960
     ctgaggtcaa atctggacaa attgttaaca accttccttg aggaaaacaa atcggccatt      1020
     cgccgtattg gagttagggt tgccgggtta caggaagtat cgtctcagac aacgcttgct      1080
     tcttattttt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page