(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE354

CP001994.PE354       Location/Qualifiers
FT   CDS_pept        376839..377264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0360"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR001011:IPR000326; KEGG: spl:Spea_3788
FT                   phosphoesterase PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR: Q12U33
FT                   Phosphoesterase, PA-phosphatase related; PFAM: PAP2
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35892"
FT                   /db_xref="GOA:D5E9P1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P1"
FT                   /protein_id="ADE35892.1"
FT                   /translation="MVPLTIAGNLFIWLLIAAFLYIFKGKSYAVYYLSLLLIIWLVVYG
FT                   MKSLFMVPRPETGRILVEAAGNSFPSGHTALAFGTATFLHPVSGKSSYMFWIFAMMMGI
FT                   SRITVGVHYPSDVVAGAIAGIILGYAGLLLYPAFVKK"
     atggttcccc tgacaatagc gggaaatctg tttatatggt tgttaatcgc tgcatttcta        60
     tatatattta aaggtaagtc ctatgcagtc tattacttgt cacttttgtt aataatatgg       120
     ctggttgttt atgggatgaa atcgttattc atggttccca gaccagaaac aggacgtatc       180
     ctggtggaag cagccggtaa ttcattcccc agcggccaca cagcactggc ttttggaact       240
     gccacttttt tgcatccagt gtcaggcaaa tcaagttata tgttctggat atttgccatg       300
     atgatgggaa tcagccgtat tacagtaggt gtacattatc cttcggatgt tgtagcaggt       360
     gcaatagcag gtattattct gggttatgca ggtttgcttt tgtatcctgc atttgtaaaa       420
     aagtaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page