(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE357

CP001994.PE357       Location/Qualifiers
FT   CDS_pept        379345..380673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0363"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="COGs: COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   InterPro IPR019293:IPR013749:IPR004399; KEGG: sat:SYN_01521
FT                   phosphomethylpyrimidine kinase / hydroxymethylpyrimidine
FT                   kinase; PFAM: Phosphomethylpyrimidine kinase type-1;
FT                   Phosphomethylpyrimidine kinase; SPTR: Q8Q000 Putative
FT                   phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase; Archaeal
FT                   phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35895"
FT                   /db_xref="GOA:D5E9P4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P4"
FT                   /protein_id="ADE35895.1"
FT                   /translation="MSNTKVALTIAGSDSGGGAGIEADIRTFSALGMHPTCAVTCITSQ
FT                   NTMGLQDSMEVPISHISSQIDAVCTDMDVKWAKTGMLSSPEIIAAVASEVKKHRLKLVV
FT                   DPVMTAEAGGTLLAESALSTLKETLLPLAFVVTPNIYEAKALSGVTINTWEDGQKAARR
FT                   IAKFGVDNVIITGGHFDASDLVYESHNDTFTTISSRFVKGGTHGSGCTYSAALLVYLSN
FT                   GLRVPEASRCAKRFVENAISRSTDVGMGVSPVDSLAFLRNSAAKYHTLVNTTDALDTLI
FT                   SEKTFSKLIPEVGCNIAMATPEAETISDVAGVHGRITRSKGRPVASGCVGFGASKHVGS
FT                   VVLAAIHSNPEIRACLNVKYSKEVLAACSQMGFGIASFERKDEPSHVSTMDWGTAYAIG
FT                   KYGKVPEVIYDEGDVGKEPMIRLLGRNATDVVEMALKIVERIN"
     atgagcaata caaaagtggc ccttacgata gcaggttcgg attccggcgg aggtgccggt        60
     atagaagcag acattcgcac tttttcagca ttgggaatgc atcccacatg tgctgtcaca       120
     tgcatcacct cccagaatac aatgggactg caggattcaa tggaggttcc tatatcccat       180
     atatcctccc agattgatgc ggtatgtacg gatatggacg taaaatgggc aaaaacagga       240
     atgctttctt ctcctgaaat cattgctgcg gttgcatcag aggttaagaa gcaccgtctt       300
     aaacttgttg tggatccggt aatgactgcc gaggcaggag gtactttgct tgctgaatct       360
     gctcttagta ccctgaaaga aacattattg cctctggctt tcgttgtaac acccaatata       420
     tatgaggcaa aagccctgtc aggagttacg ataaacacct gggaagatgg gcaaaaagca       480
     gctcgcagga tagcaaaatt cggtgtggat aatgtaataa ttacaggagg tcattttgat       540
     gcttcggatc ttgtctatga atcccacaat gacacattta caacaatatc aagtcgattt       600
     gttaaaggag gaactcatgg ctcaggctgt acctattcgg cggctctgct tgtttatctc       660
     tcaaatggat tgagagttcc cgaagcttca aggtgtgcca aaaggtttgt agaaaatgcc       720
     atttccagaa gtaccgatgt tggaatgggt gtatcccctg tagactcact tgcttttctg       780
     cgtaattcag ctgcaaaata tcataccctt gtgaatacta ctgatgcact tgataccttg       840
     atttcggaaa agacattttc aaaacttatc cctgaggtag ggtgcaatat tgccatggca       900
     acccctgagg ctgaaacaat atccgatgta gccggtgtac acggtcgtat aacccgttca       960
     aaaggcaggc ctgtggcatc agggtgtgtt gggttcggtg ccagtaaaca cgtcgggagt      1020
     gtggtacttg ctgctatcca ttccaatcct gaaatcaggg catgtctgaa tgttaagtac      1080
     agcaaggagg tacttgctgc ctgtagtcag atgggttttg gtattgcttc ttttgaacgc      1140
     aaggacgaac cttcccatgt gagtacaatg gattggggca cggcttatgc aataggaaaa      1200
     tatggtaagg ttccggaagt catatatgat gaaggcgatg tcgggaaaga acccatgata      1260
     agactgcttg gcaggaatgc tacagatgtg gtggagatgg ccctgaaaat agtcgaaaga      1320
     attaactga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page