(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE358

CP001994.PE358       Location/Qualifiers
FT   CDS_pept        380763..382019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0364"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="COGs: COG3264 Small-conductance mechanosensitive
FT                   channel; InterPro IPR006685; KEGG: pin:Ping_1734 MscS
FT                   mechanosensitive ion channel; PFAM: MscS Mechanosensitive
FT                   ion channel; SPTR: Q8PV83 Putative transport channel
FT                   protein; PFAM: Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35896"
FT                   /db_xref="GOA:D5E9P5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P5"
FT                   /protein_id="ADE35896.1"
FT                   /translation="MFDDFYSTIVIVILTLLVVLLLQYLFKKTLIFKGDTFIRNLFFTL
FT                   IIFLGMMLVIFSLPISSDSKQIIVSAIGIIVGATVALSSTTFVSNGMSGIMIRLIKPFY
FT                   VGDYIRSDEIFGRVTDKTILYTRIQSEYRDLITVPNLKIMSNPLTTIRSSGTIISTNVS
FT                   LGYDVCRQDIETALLKAADETGLKDPFVHVLELGDFSVTYKVGGLLKETKALLTERSNF
FT                   KKAVLDSLHRMDIEIVSPTFMNQRVMKNGKRFIPPLRENKKDEEEFRADRDYIPRVSTE
FT                   EIIFDKAIEAEMLDKARKTLEYFDNKKDKVEKQISCLPDESAEIQKNNWSSIKDRLGNI
FT                   EQIVEALEKAPEPGEMESSPEGLLHSKVLEHLRSIMDSILEDYNQMVETMESESCEIED
FT                   KKSDELSDSGESVSENDVN"
     atgttcgatg atttttattc gactattgta atagttatat tgacattact ggtggtcctt        60
     cttctccagt atcttttcaa gaaaactttg attttcaaag gtgacacttt cataaggaat       120
     cttttcttta cccttataat attcctgggt atgatgctgg ttatattttc cctgccgata       180
     tccagtgatt caaaacagat tattgtaagt gcgataggta ttattgttgg tgctacggta       240
     gctctttctt ctaccacttt tgtttcaaac ggaatgtcag gtataatgat ccggctcatc       300
     aaaccattct atgtgggtga ttacataaga agcgatgaaa tctttggcag ggtgacggac       360
     aaaactatac tctatacacg aattcagtcc gaatatcgtg atcttatcac cgtgccaaac       420
     ctgaaaataa tgtccaatcc cctgactacc atccgctcgt cgggaaccat aatctctact       480
     aatgtttcac tgggttatga tgtatgccgg caggatattg aaacagccct tctaaaggcg       540
     gctgatgaga caggtctgaa ggatcctttc gtacatgttc ttgagctggg ggatttctcc       600
     gtcacctaca aggtgggggg tctgctgaaa gagactaaag ccttgctaac tgaacgttct       660
     aattttaaga aggcagtgct ggattccctt cataggatgg atatcgaaat tgtatcccct       720
     acattcatga accagagggt catgaagaat ggtaaacgat tcatcccgcc cctgagggaa       780
     aataaaaagg atgaggagga attccgggct gatagggatt atattcccag ggtatccacc       840
     gaagaaatca tttttgataa ggctatagag gctgaaatgc tggataaagc tcgaaaaacg       900
     ctggaatatt tcgataataa aaaggataaa gtggaaaaac aaatttcctg ccttcctgac       960
     gaatctgccg aaatccagaa gaataattgg tcttctataa aggatcgatt gggcaacata      1020
     gagcagattg ttgaggcact ggaaaaagct ccggaaccgg gagaaatgga atcatccccc      1080
     gaaggcctgc tccattccaa ggtacttgaa cacctccgtt ccatcatgga cagcattctt      1140
     gaagattata accaaatggt ggaaacaatg gaatctgagt cctgtgagat tgaggataaa      1200
     aaatctgatg agttatccga tagtggtgaa tctgtcagtg aaaatgatgt taattaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page