(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE360

CP001994.PE360       Location/Qualifiers
FT   CDS_pept        complement(382705..383226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0366"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006015:IPR006016; KEGG: maq:Maqu_0351 UspA
FT                   domain-containing protein; PFAM: UspA domain protein; SPTR:
FT                   Q12U28 UspA; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35898"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P7"
FT                   /protein_id="ADE35898.1"
FT                   /translation="MVYNTILITTDGSENARKAVQKGIELARACGSKVYALYVMEMNPV
FT                   GITREAIHRDWKTAMQVSLPEHISPAQWREFAKIADENWKIERKKHLEEKAENILSYVE
FT                   ELGKNKDVNVEKVHIEGKPANEILDFASDKKVDLIVMGTLGMGSDGTFRLGRVAERVIH
FT                   NAGCDVMSVR"
     atggtatata acactatatt gataactacc gacggttctg aaaatgcacg aaaagcagtg        60
     caaaagggaa tagaactggc aagggcttgt ggctcaaagg tctatgcact ttatgtaatg       120
     gaaatgaatc ctgtaggcat taccagggaa gcaatacaca gggactggaa aacggcaatg       180
     caggtgtcgc ttccagaaca catatctccg gcccaatggc gcgaatttgc aaagattgcc       240
     gatgagaact ggaaaattga gcgcaagaaa cacctcgagg aaaaagcaga aaatattctt       300
     tcctacgtcg aagaactcgg gaaaaataaa gacgtaaatg tcgaaaaagt acatatcgaa       360
     ggcaaaccgg caaacgagat ccttgatttt gcctccgaca agaaggtcga cctgattgtt       420
     atgggtacat tgggtatggg ttctgacggg acattccggc tgggacgtgt agcagaaaga       480
     gtaatccata atgccggctg tgatgtaatg tcggtcaggt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page