(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE363

CP001994.PE363       Location/Qualifiers
FT   CDS_pept        complement(386450..387517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0369"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789; KEGG: mmb:Mmol_0499 two
FT                   component transcriptional regulator PhoB, winged helix
FT                   family; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Q12U26 Response regulator
FT                   receiver; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35901"
FT                   /db_xref="GOA:D5E9Q0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q0"
FT                   /protein_id="ADE35901.1"
FT                   /translation="MSGEDTAEIMDTFREGLADKTTVFLAPASVSSERLIYFYIQSILE
FT                   NDDQKHIIWLCLKNSRDKVIANFRDYGMEIEDHLDRMWFIDIEDPSKEKKENTLYYSSQ
FT                   TDYMKIGSHTSKLFSEMPGSTMVIDDLNILSKDNLQVVENFLEYIMSNVHQQEGSAVSM
FT                   LNKGVAGEKEGTLASFFDVVIEISDTGEMHVEMGLKSLDVKYVVEKGKINLYYIQKKIK
FT                   KERLNILIVDDEPDIPDLLKLSLKDEPYDFLVAYNGKDAIEIAREKIPDLILLDIMMPD
FT                   MDGYEVVETLKKERDTRDIAIIMITAKTKVDDKLKGMELGIDDYISKPFDKREVNARIK
FT                   MVMKRFGWKPPEEKE"
     atgtccggcg aagataccgc agagattatg gatacttttc gtgaaggact tgccgacaag        60
     actactgttt ttctggctcc tgcaagtgta tccagtgaaa ggttaatcta tttttatatt       120
     cagtccatac tggaaaatga tgatcaaaaa catataatct ggctctgtct gaaaaactca       180
     agagacaagg taatagctaa ttttagagat tatgggatgg aaattgaaga ccacctggat       240
     agaatgtggt ttatagatat tgaagaccct tcaaaagaaa aaaaagaaaa taccctttac       300
     tattcttccc agaccgatta tatgaaaatc gggtcacata cctcaaaact attttctgaa       360
     atgcccgggt caacaatggt tattgatgac ctgaatatcc tttcaaagga caatcttcag       420
     gttgttgaga atttcctgga atatatcatg tcaaatgtcc accagcagga gggaagcgct       480
     gtatcaatgc tcaacaaagg cgttgctggt gaaaaagaag gcacattggc ctcctttttc       540
     gatgttgtca tcgagatctc agataccgga gagatgcatg ttgaaatggg actgaaaagt       600
     cttgatgtga aatacgtagt ggaaaaggga aaaataaatc tatactatat ccagaaaaag       660
     atcaaaaaag aaaggctaaa tatacttatt gtggatgatg aacccgatat tcccgacctt       720
     ttgaaattgt cccttaaaga tgaaccctac gattttttgg ttgcatataa cgggaaagat       780
     gccattgaaa ttgcaagaga aaaaataccc gaccttatat tgctggatat aatgatgcca       840
     gatatggacg gttatgaggt cgttgagacc ctgaaaaagg aaagggacac aagagacatt       900
     gcaattataa tgatcacagc caaaacaaaa gtagatgaca aactaaaggg aatggaactg       960
     ggtattgatg actatatttc aaagcccttt gacaaaagag aagtcaatgc ccgtataaag      1020
     atggttatga aacgttttgg ctggaagcct ccggaagaaa aagaataa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page