(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE367

CP001994.PE367       Location/Qualifiers
FT   CDS_pept        392620..393099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psa:PST_0499 choline transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35905"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q4"
FT                   /protein_id="ADE35905.1"
FT                   /translation="MNMWEQKLRDIFQMEKKNSGERTTEEMNVRFAELNMRDFFKHVVF
FT                   PAYDDLKKEIEKYGRIVEVNVDDTGMNSASLTVYVPSDKNPDEQVEEFYFEIRGRAYQR
FT                   AGFAFPAHADEEQPRIRKVEILLRNGTVDEYDIENLTREDIIECFVAEYSKWINY"
     atgaatatgt gggaacaaaa attgcgggat attttccaga tggaaaagaa aaactccggg        60
     gaaaggacta cggaggaaat gaatgtcaga tttgcagaac tcaatatgag ggattttttc       120
     aaacatgtgg tatttcctgc ctatgacgac ctgaaaaagg aaattgaaaa atatggcagg       180
     attgttgagg tcaatgtgga tgatacgggg atgaattccg cctctctgac agtttatgtt       240
     ccctccgaca aaaaccctga tgaacaggtt gaggaattct attttgagat aaggggtagg       300
     gcctaccaaa gggccggttt tgcttttccg gcacatgcag atgaagagca gccacgtatc       360
     cgtaaggtgg aaatattact tcgcaatggt actgtcgatg aatatgatat agagaatctg       420
     acccgggaag atatcatcga atgctttgtc gctgaatatt ccaagtggat caattactga       480
//

If you have problems or comments...

PBIL Back to PBIL home page