(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE374

CP001994.PE374       Location/Qualifiers
FT   CDS_pept        complement(398747..399472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0380"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="COGs: COG0476 Dinucleotide-utilizing protein
FT                   involved in molybdopterin and thiamine biosynthesis family
FT                   2; InterPro IPR007901:IPR000594; KEGG: aeh:Mlg_1160
FT                   molybdopterin biosynthesis protein MoeB; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB domain
FT                   protein; SPTR: Q8TU19
FT                   4-methyl-5-(Beta-hydroxyethyl)thiazole monophosphate
FT                   synthesis protein ThiF; PFAM: MoeZ/MoeB domain; ThiF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35912"
FT                   /db_xref="GOA:D5E9R1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R1"
FT                   /protein_id="ADE35912.1"
FT                   /translation="MLNDVDKELYSRQIMMIGEDGQDKLKGATVLVAGCGGLGSPVLNY
FT                   LAVAGIGHIRLIDKDTVELSNLNRQILHWHRNIGKPKSLSAQEKLGELNPNIKLEAINA
FT                   EINADNADELAQGVDIIVDALDNYDTRVLLNRMAINKGVPLVHGAVHGFHGQVTTIIPG
FT                   KTPCIECLIPEKPPKEIFPIIGCTAGIVGTMQANEVIKYLLGREDLHSGHIVMWDGRSG
FT                   TLDRMKICRRMDCPECGHL"
     atgctgaatg atgtggataa ggaactttac agccgccaga tcatgatgat cggagaagac        60
     ggccaagata aactcaaagg ggcaaccgta cttgtggccg gctgcggggg gcttggctct       120
     cccgttttga attacctggc cgttgccggg atcggccata tccggcttat cgataaggat       180
     accgttgagc tgagcaatct caacaggcag atattacact ggcaccggaa catcgggaaa       240
     cccaaaagcc tatctgctca ggagaagcta ggtgaactca accccaatat aaagctggaa       300
     gcaatcaatg cagagatcaa tgccgataat gcggatgaac tagcgcaggg agtagatatt       360
     atagtcgatg ccctggataa ctacgacacc agggttttgc tcaacaggat ggcaatcaat       420
     aaaggtgtgc ctctggtcca cggtgctgtc cacggattcc acggccaggt cacaacgatc       480
     atcccgggaa aaacaccttg tatcgaatgc ctcatacccg aaaaaccacc aaaagaaata       540
     ttcccgatca tcggttgcac cgcaggtatc gtaggtacga tgcaggcaaa cgaggtgatc       600
     aagtatctgc ttggccggga agatttacat agcggccata ttgtaatgtg ggatggcagg       660
     agcggaacgt tagacaggat gaaaatatgc cgcaggatgg actgcccaga gtgcggccat       720
     ttataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page