(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE376

CP001994.PE376       Location/Qualifiers
FT   CDS_pept        complement(399872..401065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0382"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="COGs: COG1104 Cysteine sulfinate
FT                   desulfinase/cysteine desulfurase;
FT                   InterProIPR001597:IPR000192:IPR020578:IPR006025:IPR 017772;
FT                   KEGG: sat:SYN_01251 cysteine desulfurase / selenocysteine
FT                   lyase; PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; SPTR: A2SQ36
FT                   Aminotransferase, class V; TIGRFAM: cysteine desulfurase
FT                   NifS; PFAM: Aminotransferase class-V; TIGRFAM: cysteine
FT                   desulfurase NifS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35914"
FT                   /db_xref="GOA:D5E9R3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R3"
FT                   /protein_id="ADE35914.1"
FT                   /translation="MKNNNKNTGNTVYLDHAATTFTDPVVLETMLPYFTENFGNPSSPY
FT                   NIAHISREALDKARQQVADAINADTEEIYFTSGGTESDNWAIKGVAFANRKRGNHIITS
FT                   AIEHHAVLHTCQWLEKQGFEVTYLPVDKYGQVRTEDVKRAIRGDTILISVMLANNEIGT
FT                   IQPIPEIGRIARKKGIYFHTDAVQGIGQIPVDVEALNVDLLSLSSHKFYGPKGVGALYI
FT                   KKGSRIDNHSHGGAQEKKKRAGTENVPGIVGMGAAIEQAISQLEEHAAHMKKLRTRLLE
FT                   GLLQIPATHLAGHPEKRLPNNVNVIFEYIEGESILLMLNSFSIAASTGSACTSASLEPS
FT                   HVLIACGFPHEIAHGSLRLTLGKENTEDDVDYVLQIIEPIIKRLRAMSPMTPEELRK"
     atgaaaaaca ataataagaa tacaggcaat accgtctatc tggaccatgc agccaccacc        60
     tttacggatc cagtggtttt agagacaatg ttgccgtatt tcaccgagaa ttttggcaat       120
     ccctcctcac cttacaacat cgcccacata tccagagaag cgctcgataa agcccgtcag       180
     caggtagccg atgccatcaa tgcggacacc gaagagatat atttcacaag tggggggacc       240
     gaatccgata actgggctat taagggcgtt gcatttgcca acaggaaacg gggcaaccat       300
     ataatcactt ccgccattga acatcatgca gtcctgcata catgccagtg gctggaaaaa       360
     cagggatttg aggtaaccta tctaccagtg gacaaatacg gacaggtcag aacagaggat       420
     gtaaaaagag ccatccgggg cgataccatc ctgatatctg taatgctggc aaacaacgaa       480
     atcggcacaa ttcagccaat cccggagatc ggcaggatag cccggaagaa gggtatctat       540
     tttcacacgg atgcagtgca ggggattggc cagatacctg tagatgtgga agccctgaat       600
     gtggatttac tctccctctc ttcccacaag ttctacgggc caaagggagt aggtgccctg       660
     tatatcaaaa aaggcagccg gatcgataac catagccatg ggggtgccca ggaaaagaaa       720
     aaaagggcag gcacagaaaa tgttcccggt attgtgggaa tgggcgcagc tatcgaacag       780
     gcaatatctc aactggaaga acatgccgct cacatgaaaa agctgagaac acggttgtta       840
     gaaggccttc tgcagattcc ggccacccac cttgcaggcc atcccgaaaa acgcctgccc       900
     aacaatgtga acgtgatctt tgagtacata gaaggggaat ccatcctgtt gatgctgaat       960
     tcgttctcta ttgcagcttc taccggcagt gcctgcacct cggcttccct tgaaccgtcc      1020
     catgtgctca ttgcctgtgg attcccccat gaaatcgcac acggatccct acgcctgacc      1080
     ctgggtaagg agaatacgga agatgatgtg gattacgttc tccagataat agaaccgatt      1140
     atcaaaagac tcagggcaat gtcacctatg acaccagagg aactgaggaa gtga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page