(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE377

CP001994.PE377       Location/Qualifiers
FT   CDS_pept        401272..401607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0383"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG2522 transcriptional regulator protein;
FT                   SPTR: Q12Z32 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35915"
FT                   /db_xref="GOA:D5E9R4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R4"
FT                   /protein_id="ADE35915.1"
FT                   /translation="MKRENMKIETPCQVVVWDVLPAIRAALAKELVDNGVTQQEVARLF
FT                   GMAPSAVSQYLTKKRGYRIEFDDNIKVSIANLAADIQNGKVDDLSHRFCDICRQLRADD
FT                   ACPAGED"
     atgaagcgtg agaatatgaa aattgaaact ccgtgtcagg ttgtggtgtg ggatgtcctg        60
     cccgccataa gggccgccct tgcaaaagaa ttggtggata atggtgtaac ccaacaggaa       120
     gtggccaggc ttttcgggat ggcgccgtca gcggtttccc agtaccttac caaaaaaagg       180
     gggtacagga ttgaatttga tgacaacata aaagtttcca ttgcaaatct tgcggccgat       240
     atccagaatg gtaaagtaga tgatctgtcg cacagatttt gcgacatctg ccgccagctg       300
     agggcggatg acgcctgtcc tgctggtgaa gactga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page