(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE38

CP001994.PE38        Location/Qualifiers
FT   CDS_pept        complement(42076..42387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_0088 hypothetical protein; SPTR:
FT                   A9A735 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35576"
FT                   /db_xref="GOA:D5E8R7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R7"
FT                   /protein_id="ADE35576.1"
FT                   /translation="MNHIVKSAKKTLNALNQSLPVVVGVIMAISLLKAAVPESLYSTIF
FT                   TGNILIDPFIGSLIGSIAAGNPITSYIIGGELIKQGVSLFAVTAFLLSWVTVGIMGEL"
     atgaaccata ttgtgaaaag tgcaaagaag accctgaatg ctttgaatca aagtttgcct        60
     gtcgttgtgg gagtcataat ggcgatcagc cttctcaaag ctgcagttcc tgaatctctc       120
     tactctacaa tctttaccgg caatattctg attgatcctt ttataggaag tctcatcggc       180
     agtatcgctg caggaaatcc aattactagc tatataattg ggggcgaact tatcaaacaa       240
     ggtgtatctc tttttgctgt tacagccttc ctgttaagct gggttactgt aggaattatg       300
     ggagaactgt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page