(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE383

CP001994.PE383       Location/Qualifiers
FT   CDS_pept        complement(407837..408151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0389"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1594 DNA-directed RNA polymerase subunit
FT                   M/Transcription elongation factor TFIIS; InterPro
FT                   IPR001529:IPR001222:IPR019761:IPR006288; KEGG: hypothetical
FT                   protein; K03019 DNA-directed RNA polymerase III subunit
FT                   C11; PFAM: Transcription factor TFIIS; DNA-directed RNA
FT                   polymerase, M/15 kDa subunit; SMART: Transcription factor
FT                   TFIIS; DNA-directed RNA polymerase, M/15 kDa subunit; SPTR:
FT                   Q12U17 DNA-directed RNA polymerase, subunit M; TIGRFAM:
FT                   transcription factor S; PFAM: RNA polymerases M/15 Kd
FT                   subunit; Transcription factor S-II (TFIIS); TIGRFAM:
FT                   transcription factor S, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35921"
FT                   /db_xref="GOA:D5E9S0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S0"
FT                   /protein_id="ADE35921.1"
FT                   /translation="MEFCPKCKSMMFPSDGDLKCRKCGYEKSREEGAETMVSKTKRDER
FT                   EVTVLEENVDEGLPTTLAQCPECGNNKAYWWMRQLRSADESETRFFKCTKCSYTWREYD
FT                   "
     atggaatttt gtccaaaatg taagagtatg atgtttccca gcgacgggga ccttaagtgt        60
     cgcaaatgtg gatatgagaa aagcagggaa gaaggcgcag aaaccatggt ttcgaaaacc       120
     aaacgtgatg aacgtgaggt tacagtgctt gaggaaaatg tcgatgaagg gttacctaca       180
     acacttgccc agtgtccaga atgcggaaat aataaagcat actggtggat gcgacagcta       240
     cgttcagcag atgaatcaga gacgaggttc tttaagtgta caaaatgcag ttacacctgg       300
     agagaatatg actga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page