(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE384

CP001994.PE384       Location/Qualifiers
FT   CDS_pept        complement(408129..408545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0390"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020476:IPR000086:IPR020084; KEGG: sfu:Sfum_1206 NUDIX
FT                   hydrolase; PFAM: NUDIX hydrolase; SPTR: Q12U16 NUDIX
FT                   hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35922"
FT                   /db_xref="GOA:D5E9S1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S1"
FT                   /protein_id="ADE35922.1"
FT                   /translation="MRPKTPLLTVDGVIILNGKIVLIRRKNEPYRGSFALPGGFVEIGE
FT                   TTEEAVKREVMEETGLLIEILKLVGVYSEPSRDPRGHTVSVAYLAVGKGEPRADTDAAE
FT                   VGCFDPGNLPELAFDHQRIINDAGDDIDGILSKM"
     atgagaccaa aaactcccct actaacagtc gatggcgtaa tcatattaaa cgggaagata        60
     gtacttataa gaaggaaaaa tgaaccttac aggggatcgt ttgccctgcc cggtggtttt       120
     gtagagattg gcgaaaccac agaagaagcg gtaaagagag aagtaatgga agaaacaggg       180
     cttctaatcg aaatactcaa attggttggt gtatattcag agccttcccg tgatccgagg       240
     ggtcacacag tatccgtggc ctacctggca gtaggcaaag gcgaaccccg ggcagatacc       300
     gatgctgcag aagttggatg ttttgatccc ggcaatctgc cagaactcgc ttttgaccac       360
     cagcggatca taaatgatgc aggagatgat attgatggaa ttttgtccaa aatgtaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page