(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE385

CP001994.PE385       Location/Qualifiers
FT   CDS_pept        408609..409430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0391"
FT                   /product="Exosortase EpsH-related protein"
FT                   /note="COGs: COG4083 membrane protein; InterPro IPR019127;
FT                   PFAM: Exosortase EpsH-related; SPTR: Q12U15 Putative
FT                   uncharacterized protein; PFAM: Transmembrane exosortase
FT                   (Exosortase_EpsH)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35923"
FT                   /db_xref="GOA:D5E9S2"
FT                   /db_xref="InterPro:IPR014522"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S2"
FT                   /protein_id="ADE35923.1"
FT                   /translation="MTDYILLIAIGLMILSAILPGKLSYRKLIGAFGWISFGAHWAYQP
FT                   IHYMGINDYFNVFLTIMIACFCLMMAYSMIDEYRTGILPVTNLDITSMVTSATAIGSLF
FT                   YFPFAQLPSLNYWIIATVTDNITWLLGVLGYQVTQDAWNLISYNGYTVEIILACTAIES
FT                   IALFSGLIVSVRAPAFKLFQAFIVSVPVIYILNIFRDVFVIIAYGEQWFGAESFEIAHH
FT                   MIAKMGSALALFVIGYAVLKILPQLFDLIDGLVSLSRFRLKGIIDKIAGNR"
     atgacagact acattttatt gatagcaata ggattaatga ttctttcagc tatccttcct        60
     ggtaaattat cctatcgtaa actgataggc gcttttggat ggatttcttt tggtgcgcac       120
     tgggcttacc agccaatcca ttacatggga attaacgatt attttaatgt attccttaca       180
     ataatgattg cctgcttctg tcttatgatg gcctattcta tgatagatga atataggaca       240
     ggaatactgc ctgttacgaa cctggatatc acctcaatgg tgaccagcgc tactgcaata       300
     ggttcgcttt tttacttccc gtttgcccag ttaccttcac ttaattactg gattattgct       360
     actgttacag ataacatcac ctggcttctt ggtgttctgg gctatcaagt tactcaggat       420
     gcctggaacc tgatctccta caacggctat acagtggaga ttatccttgc ctgcactgcc       480
     attgaaagta ttgccctctt tagcggcctg atcgtttctg tcagggcacc tgcttttaag       540
     ttgttccagg catttatagt ttcagtaccg gttatatata tactgaatat ttttcgcgat       600
     gtttttgtta ttatagctta tggggagcaa tggtttggtg cggaaagttt tgagattgcc       660
     caccatatga ttgccaagat ggggtcggct ttagctctat ttgtaatcgg ctatgctgtt       720
     ttgaagattc ttccccagct cttcgatctg attgatgggc ttgtgtccct ttcaaggttc       780
     aggttaaagg gaattattga taaaattgca ggaaacaggt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page