(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE39

CP001994.PE39        Location/Qualifiers
FT   CDS_pept        42516..43451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0040"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014044; KEGG: eba:ebA7184 hypothetical
FT                   protein; PFAM: SCP-like extracellular; SPTR: A1HPV1
FT                   Allergen V5/Tpx-1 family protein; PFAM: Cysteine-rich
FT                   secretory protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35577"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R8"
FT                   /protein_id="ADE35577.1"
FT                   /translation="MEKLKFLLILFLAIAFLIFPAGAENLYSAEEKQMLDLINEERAEQ
FT                   GVSPLQFNSLLNEVSSEHSRDMIENNYFAHDSYDGTSYWQRLQDFNYQSSTTAENIAMN
FT                   VPFDLQKAHANLMASPGHRTNILNPDYNEIGIGIWVGDYTCNGVTYSNAAMFTQDFGWN
FT                   TSADEKDLLSIESYSPQDNFSSDPESTQEFAVTTNRPCNIRWLMDGGEVREINNEMTSS
FT                   YTTSKPSTGTYEVKVIVDDGVSTDIREWSWTVVEDDIDSSYHAYDFNQNCLMDTSEVSK
FT                   AIDDYYAGKLDVAEISQIIDYWYLGSDGYC"
     gtggaaaagt taaaattttt gttaatatta tttctggcaa ttgcattttt aattttcccg        60
     gcaggtgctg agaatctgta ttctgctgag gagaaacaaa tgctggattt gattaatgaa       120
     gaacgtgctg aacagggggt atctccttta caattcaatt ctctgttaaa tgaggttagc       180
     agtgaacata gcagggatat gattgaaaat aattattttg ctcatgattc ctatgatggc       240
     acatcttact ggcagcgtct gcaggatttt aattatcaat cgagcactac agccgaaaat       300
     atcgcgatga acgttccctt tgacctacag aaggctcatg caaacctaat ggcttctccg       360
     ggtcacagga ctaatatcct gaatcccgat tataatgaga ttggtattgg gatctgggta       420
     ggtgattata cctgcaatgg ggttacctat tcaaatgcag caatgttcac acaggatttt       480
     ggatggaata cttctgctga tgagaaagat ctgctttcaa tagaaagtta cagcccacag       540
     gataatttct cttcagatcc tgaaagtacg caggaatttg ctgtaactac gaaccgacca       600
     tgcaatatcc ggtggctgat ggatgggggt gaggtacgag aaattaataa cgaaatgact       660
     tcctcttata ctacatcaaa accttcaact ggtacatatg aggttaaggt aatagttgat       720
     gatggagttt ctacagatat cagggaatgg tcctggactg tagtagagga tgatattgat       780
     tcttcctatc atgcttacga ttttaaccag aattgtttga tggataccag tgaagtgtca       840
     aaagcgatcg atgattatta tgccggtaag ttagatgttg cggagatttc ccaaataatc       900
     gattactggt accttggctc tgatggatat tgctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page