(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE393

CP001994.PE393       Location/Qualifiers
FT   CDS_pept        complement(417043..418386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0399"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3);
FT                   InterProIPR013027:IPR000103:IPR000815:IPR001327:IPR
FT                   004099:IPR012999; KEGG: gbm:Gbem_3786 pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SPTR: Q46EZ2
FT                   Glutathione reductase (NADPH); PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35931"
FT                   /db_xref="GOA:D5E9T0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T0"
FT                   /protein_id="ADE35931.1"
FT                   /translation="MAREYDIVIIGTGVAGTVCANKASAAGMKIAITDIREYGGTCALR
FT                   GCVPKKVLVGVAETVEQVNRFNKLGIMPQSSVNWNKLMDFKQTFVDNFPQNKEEKFTNM
FT                   DIDTYHGGAKFVSKNEVKIADTILKGKHILIAPGSVPRKTGIKGEENLITSEQFLNLDE
FT                   LPRKIVFVGGGYISFELAHIAARAGSQVTILQRSEVLKQFDRDMVKLLVKASEEAGINV
FT                   NTGISVSSVESTSSGFTVNTRNREGKESRIECDLVVNGSGRIAALEGMELEKGNVETKD
FT                   GFVETNDYMQSVSNPYVYAAGDCVKPGAPLTPVASLQGTTAADNMIKGNVKTVDYTGIP
FT                   STVFTLPPLSSVGISLSESTDRYEVLIHDRSHWYNSRRLSENYAASKVIIEKESQKIAG
FT                   AHILGSHSEEVINIFAMAIRLGLTLSQFKKVVYVFPTVSSEIQSMIRG"
     atggccagag aatatgacat tgtaatcata gggacaggcg tagcaggtac cgtttgtgcg        60
     aacaaggcat ctgcggcagg gatgaagatc gcgattacag atatcaggga atatgggggg       120
     acatgtgcac ttcgaggatg tgtaccaaaa aaagtacttg tgggtgttgc cgaaactgtt       180
     gaacaggtaa atcgtttcaa caaactggga atcatgccac aatcttccgt gaactggaat       240
     aagttaatgg actttaaaca aacttttgta gataatttcc ctcagaacaa ggaagaaaag       300
     ttcacaaata tggatattga cacctaccat ggcggggcaa agtttgtttc caaaaacgaa       360
     gtgaaaatag cagatacaat cctaaagggc aaacacattc tgattgcacc tggctcagtg       420
     ccccgaaaaa ccggaattaa gggcgaagaa aacctgatta caagtgagca atttctcaat       480
     ctcgatgaat tgccccgtaa aattgtcttt gtgggtggtg gttatatttc atttgaattg       540
     gcccatatcg ctgcccgggc aggaagtcag gtaactatct tacaaagaag cgaagtgctc       600
     aaacaatttg acagggatat ggtcaaattg ctggtaaaag cttccgaaga agccggcata       660
     aatgtcaata ccggtatctc ggtcagctct gttgaaagta cttcatctgg atttactgtg       720
     aataccagga atcgtgaggg gaaagaatcc cgaattgaat gtgacctggt tgtcaacggt       780
     tccggcagga ttgcagccct tgagggaatg gaacttgaaa agggaaatgt tgagaccaaa       840
     gacggattcg tggagacgaa tgattacatg caaagtgtct ccaaccctta tgtatatgca       900
     gccggagatt gtgtaaagcc cggagctcct ttaactcctg ttgcaagttt gcagggaact       960
     actgcagcag acaatatgat aaaaggaaat gtcaaaaccg tggattatac cggtattccc      1020
     tccacggtat ttaccctgcc tcctctctca agtgtaggta ttagcctgtc cgaatctact      1080
     gacaggtatg aagtcctgat ccatgatcgc agtcattggt ataacagcag gcgcctttcg      1140
     gaaaactatg cagcctcaaa ggtcatcata gaaaaagaaa gccaaaagat tgcaggcgct      1200
     cacatactgg ggtcccattc ggaagaagtg attaatatct ttgcaatggc aattaggctt      1260
     ggactgacac tttcccagtt caagaaagtg gtttatgtgt tccctacagt cagttcagaa      1320
     atccagtcca tgatacgtgg ataa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page