(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE395

CP001994.PE395       Location/Qualifiers
FT   CDS_pept        420008..420850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0401"
FT                   /product="methanogen marker protein 4"
FT                   /note="COGs: COG4002 phosphotransacetylase; InterPro
FT                   IPR016764; KEGG: dac:Daci_2106 malic enzyme; SPTR: Q12TX0
FT                   N5-methyl-tetrahydromethanopterin--coenzyme M
FT                   methyltransferase subunit X; TIGRFAM: methanogen marker
FT                   protein 4; TIGRFAM: putative methanogen marker protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35933"
FT                   /db_xref="GOA:D5E9T2"
FT                   /db_xref="InterPro:IPR016764"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T2"
FT                   /protein_id="ADE35933.1"
FT                   /translation="MQKKTDGLLDIIRTRALDNCPRVALGVRNPTPKLIQSAEKAEVEG
FT                   YARVVLVGDQRDISAIGTNLEVIDTPQPEEVLGSLLASGDVDAAVRGTAKASGTLSHLK
FT                   EILGIEKLYRVAFLLTHDNNPFFLAPVGIDEGHSLSDKIELVKRSAAYIRRFGIEPEVG
FT                   ILSGGRMGDLGRDERVDRTLADADFLANRLNDAGIDAKHYTILIEDAIRESNFILAPDG
FT                   ISGNLIFRSLVFLGGGNGIGAPVLMDRHVFIDTSRVGGHYTLAIMLAASLVSNKREVV"
     atgcagaaaa aaacagacgg attgctggat atcatacgta caagggctct tgataattgt        60
     ccccgggttg cactgggtgt gcgcaatccc actcccaaac tgatccagag tgcagaaaaa       120
     gccgaggttg aaggttatgc cagggtggtt cttgtaggcg accagcgtga tatatcggca       180
     atcgggacaa accttgaagt gatcgatacc ccgcaaccgg aagaagttct cggcagtctg       240
     cttgcatccg gggatgttga tgctgctgta aggggcacgg caaaagcctc tggtaccctg       300
     tcccacctca aagagatact cggcatcgaa aaattatata gggttgcttt cctgctaact       360
     catgacaata atccattttt ccttgcacct gtgggtatcg atgaaggcca ctccctttcc       420
     gataaaatag agcttgtaaa aagaagtgct gcatatatcc gcaggtttgg tatcgagcct       480
     gaggttggca tcctgtcggg agggcgtatg ggggaccttg gccgggacga acgtgtggat       540
     cgcaccctgg cggatgcgga ttttctggca aaccgattaa atgatgcagg aatagatgcg       600
     aaacattaca cgatccttat agaggatgcc atcagggaat ctaacttcat ccttgccccg       660
     gatggcatat caggtaatct tatcttccgt tcactcgtat ttctgggagg gggcaatgga       720
     ataggggcac ccgtacttat ggacaggcat gtgtttattg acacatcccg ggtggggggt       780
     cattataccc tggccataat gcttgccgca tctcttgttt ctaacaaaag ggaggttgtg       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page