(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE40

CP001994.PE40        Location/Qualifiers
FT   CDS_pept        complement(43601..44392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0041"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; SPTR: Q8PXM7 Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35578"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R9"
FT                   /protein_id="ADE35578.1"
FT                   /translation="MNTIKSKGKSHRSGARVFTTILYALLMIAVAIPLSSAAVTELSVY
FT                   PDYPVVGEDIKINGTAQPDEVLDITVSFNQTVNVSDGTYKYRIDDVEIPDGSNTFQVRG
FT                   EKVKDLNVRVKILFWITKSADADSGVATVSQSNVPSGTYDIIIDGHAEDGESTVNLTIN
FT                   ASSSIKADTEGYFEDNYTTNSIPPGIFELSAGKINETITLYEEPVVIQPEYDVYDANQN
FT                   CIIEMGELSAGIDDFFTGHLSINKLSQLIGYFLSGDTYCQN"
     atgaatacta tcaaatctaa aggtaaatca cacagaagcg gtgctagagt ttttacaaca        60
     atactatacg cattgcttat gattgctgtt gcaatacccc tctccagtgc tgctgtcaca       120
     gaattatccg tatatcccga ttatccagtt gtgggagagg acataaaaat aaatggtact       180
     gctcaacctg atgaagtact cgatataact gtttctttta atcaaactgt caatgtatct       240
     gatggcactt acaagtacag gatagatgat gttgaaattc ccgatggatc caatactttt       300
     caggtgagag gtgagaaagt taaagacctg aatgtccggg ttaagatatt gttctggatt       360
     acaaagagcg cagatgctga ttccggagtt gcaacagtat cccaatcaaa cgtaccatca       420
     ggaacttatg atattataat tgatggccat gcagaggatg gagaatcaac tgtcaacctt       480
     accatcaatg catccagctc gataaaggca gatacagagg gttattttga agataattat       540
     accaccaatt caataccacc cgggatattt gaattaagtg ctggcaaaat taatgaaaca       600
     attaccctct atgaggaacc agtagtaatc cagcctgaat acgatgtata tgatgcaaac       660
     cagaactgca taattgagat gggagaactt tctgcaggga tagatgattt ttttaccggc       720
     cacctttcca tcaataaact ctcacagttg ataggttatt tcctttcagg ggacacttat       780
     tgccagaatt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page