(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE400

CP001994.PE400       Location/Qualifiers
FT   CDS_pept        424754..426289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0406"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1031 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR006638; KEGG: tmz:Tmz1t_0865 tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: Q12TW6
FT                   Fe-S protein, radical SAM family; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35938"
FT                   /db_xref="GOA:D5E9T7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T7"
FT                   /protein_id="ADE35938.1"
FT                   /translation="MKVAIIDGYVDEPACFGVPPYISPYIRYIAGALVECGIGRDDISY
FT                   FTIDGIRNSKREDLAPLSRSDLVVILSGMTVPGKYLRSSPITLKEIEYLCRATSGVKVI
FT                   GGPIRLGYSSEGGMAASTLEMADEDVFVARQDIEAFVHDIIGPGPCIEDPDNVEHRMRT
FT                   VGEIGRWADRGAFIIRRHPDFPNIMCEMETYRGCGRDTHCSFCTEFFYGPSTYRPVEDV
FT                   VTEAGSLYREGALYFRLGRQPDLFTYHALDCGDSLPGPNPQALESLYSGIRKVAPGLEV
FT                   LHMDNANPATIATYPDECSKIMKTILKYHTPGDVAAMGMESADPAVIRANNLKAMPDDV
FT                   FEAVKLMNEIGSIRGDNGLSHLLPGLNFVHGLAGETKKTFGLNYDFLKNILDNDLLLRR
FT                   INIRQVMPFSGTPAAEQALPLAKNRKIFLKYKEQVRKDIDLPMLRRVVPRGTILKDVLC
FT                   EVWGEGSVGTFGRQMGSYPILIGISEKLPLGEFVDVRVTGHGFRSISATVVRE"
     atgaaagttg caatcataga cggttatgtt gacgaacccg catgtttcgg cgttcccccc        60
     tatatttctc cctacatacg ctatatagcg ggagccctgg tagagtgtgg tatcggtcgg       120
     gatgatatat cctatttcac tatagacggt atcaggaaca gtaaaaggga agaccttgcc       180
     ccgctttccc gatctgatct cgtggtaatc ctgtcgggaa tgaccgtccc cggaaagtac       240
     ctgcgctcct cacccatcac cctgaaagaa attgaatacc tttgcagggc cacgtcgggt       300
     gtgaaagtga tcggtgggcc tatacgcctg ggttacagca gtgaaggcgg catggcagcg       360
     tcaacccttg aaatggctga tgaagatgta tttgttgcac ggcaggacat cgaggcattt       420
     gtgcatgata taattggccc cggtccctgc atagaggatc ctgataatgt tgaacaccgg       480
     atgcgtacgg ttggggagat cggcagatgg gctgacaggg gtgcctttat aatcaggcga       540
     catccggatt tcccgaatat aatgtgtgag atggaaacct atcgcggatg tggcagggat       600
     actcactgtt ctttctgtac tgaatttttt tatggtccgt caacctatcg tcccgtggag       660
     gacgtagtta ccgaggccgg gagtctctat agggaaggtg ccctgtattt ccgcctgggt       720
     cgccaacctg atcttttcac ctatcatgca ttggattgtg gggattctct cccagggcca       780
     aacccgcagg cgcttgaatc cctgtattcg gggattcgga aagtggctcc gggtctggag       840
     gtactgcata tggataatgc caatccggca actatagcca cctacccgga tgaatgtagt       900
     aaaataatga agaccatttt gaaatatcac acacctgggg atgtagcagc catgggtatg       960
     gaaagtgccg atcctgctgt aatcagggcc aacaatctca aagcaatgcc agatgatgtg      1020
     tttgaagctg taaaattgat gaatgagatt ggaagcataa ggggtgacaa tggtctttca      1080
     catctgcttc ccgggcttaa ttttgtccac ggtctggcag gagaaacaaa aaaaaccttc      1140
     ggtttgaatt atgattttct gaaaaatatt ctggataatg atcttttgtt gcgcaggata      1200
     aacattcgcc aggttatgcc ctttagtggt actcctgcag cagaacaggc gttgcctctg      1260
     gccaaaaacc gaaaaatttt tttgaaatac aaggaacagg tccgcaagga tatcgatttg      1320
     cccatgttga gaagggtagt gccccggggt actatactca aggatgtgct ttgtgaggtt      1380
     tggggtgagg gttctgtggg tacctttggc aggcagatgg gctcctatcc gatacttata      1440
     ggtatctcag aaaaacttcc tctgggcgaa tttgttgatg tgagggtaac aggtcacggt      1500
     ttcaggtcca tttcagcaac agtggttcgt gaatga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page