(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE408

CP001994.PE408       Location/Qualifiers
FT   CDS_pept        433521..435818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0415"
FT                   /product="CoB--CoM heterodisulfide reductase subunit A"
FT                   /note="COGs: COG1148 Heterodisulfide reductase subunit A
FT                   and related polyferredoxins; InterPro
FT                   IPR001450:IPR003813:IPR017900; KEGG: dal:Dalk_1624
FT                   methyl-viologen-reducing hydrogenase delta subunit; PFAM:
FT                   methyl-viologen-reducing hydrogenase delta subunit; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Q8PZV2
FT                   Heterodisulfide reductase subunit HdrA; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase;
FT                   Methyl-viologen-reducing hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35946"
FT                   /db_xref="GOA:D5E9U5"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U5"
FT                   /protein_id="ADE35946.1"
FT                   /translation="MNDSKKPSGIFICHCGGNISDNIDIKKLKDSFPDCKVFDYEYLCS
FT                   NRGQQYLKDEIENSGLERVVVGACTPAKHENLFKKCASQCGINQEFLRVVNLREQCSWV
FT                   HTDSDRATHKAFSMLNSSMLRLFRAQPVEQYSLPINPDALVIGGGIAGINAALNLANSG
FT                   VHTYLVEKETTIGGNAAKIGKIFSPEKLVEECAMCSLSPLMNEVASHPKIELLTDCEIR
FT                   NIDSITGNFQVSITQNPRYVTDKCVCCGKCAAVCPVVTENEFNCGSKDKKAVSIKFAQA
FT                   VPQIYSINPEHCIELKGGRCGKCREVCNVDAIDFSQQDKHIEIQVGAIIAATGFGEYDP
FT                   SSKPQYGYGRFPNVLTQMELARILGVNGPTQGKLLRPSDAKRPKNVVMIQCVGSRDEKS
FT                   SGNRYCSRYCCMAALKHASLIKKKYPDVNVTICYIDMRAFGLYEHYYRAVQEMAVQFVR
FT                   GRPAEIAERDNSELVVKVEDTLNQQLMELPADMVVLSAAMEPSEGTQQIARIMDTNLSE
FT                   DGFIKERHSKLRPVDTSKEGIFVCGSAQSPKDITDSIAQAGLAASRAHAFLAAGEIYLD
FT                   PHIAVADPDVCTLCGKCVTCPFGAISIEDKVKIDPLVCNGCGYCTSLCDEDAIHIRGYS
FT                   REELVAEIEGLAQAGDTIVFASCNIAYSTIDNIGSSAQDYPASTKIIRVPTTTIVTAEM
FT                   LDMAFNRGVFHVVFVEEPPDNQIGEIIYPLAEARFFELKAEYGDRLHLKKAYIPHAKGL
FT                   SDMFSSLEEVEE"
     atgaatgatt cgaaaaaacc ctcaggtatt tttatttgcc attgtggggg caatatttca        60
     gacaatattg atattaaaaa gctcaaggat tcctttccgg attgtaaagt atttgattat       120
     gagtacctgt gctccaatcg gggtcaacaa taccttaagg acgagattga aaatagcggt       180
     cttgaaaggg tagttgtggg ggcatgtacg cccgccaagc atgaaaacct tttcaaaaaa       240
     tgtgcttccc aatgcggaat aaatcaggaa tttctcagag ttgtcaactt aagggaacaa       300
     tgctcctggg tgcataccga ttccgacagg gccacccaca aagcgttttc gatgctcaat       360
     tcaagcatgc ttcgcctttt tcgggcacag cccgttgagc agtacagttt gcctataaat       420
     cctgatgccc tggtaatcgg tggtgggatt gccggtatta atgccgccct taatcttgcc       480
     aatagtggag tgcacactta tcttgtggaa aaagaaacga caataggtgg caatgccgca       540
     aagattggca agatattttc cccggagaaa ctggtcgagg aatgcgccat gtgttctctc       600
     agtcccctga tgaatgaagt tgcttctcat cccaaaatag aactgctaac tgattgtgag       660
     atcagaaata tagattcaat taccggtaac tttcaggtaa gtattactca gaatccccgg       720
     tatgtaaccg ataaatgtgt ctgttgtggt aagtgtgctg cagtatgtcc tgtagttaca       780
     gaaaatgaat tcaactgtgg ttcaaaggac aaaaaagccg tatcaataaa atttgcccag       840
     gcagtacccc agatatattc catcaatcct gaacattgca tagaacttaa gggtggcagg       900
     tgtggcaagt gcagggaggt ttgcaatgta gatgctattg atttctccca acaggacaaa       960
     catatcgaaa tacaggtggg agccattatt gctgcgaccg gttttggtga atatgatcct      1020
     tcctccaaac cccaatatgg ttacggtcgc tttcccaacg ttctaaccca gatggaactt      1080
     gcccggatac ttggtgtaaa tggccctact cagggtaaat tactgcgccc ctctgatgca      1140
     aaaaggccga aaaacgttgt tatgatccag tgtgtgggtt ccagggatga gaaatcttcg      1200
     ggaaaccgtt actgttcccg ctactgttgc atggcagctc ttaaacatgc cagtcttata      1260
     aagaaaaaat atccggatgt gaatgtcacc atctgttaca ttgatatgcg tgcctttggc      1320
     ctgtatgaac actactaccg tgccgtacag gaaatggctg tccaattcgt gcgtggtagg      1380
     cctgccgaga ttgcagaacg agataattcc gagcttgtgg tgaaggtcga ggataccctg      1440
     aaccagcaac ttatggaatt gccggctgat atggtggtac tctctgctgc catggagcca      1500
     tcagaaggta cacagcagat tgcccggata atggatacca atctaagtga agacggtttc      1560
     atcaaggaac gacattccaa gctcaggccg gtcgacactt caaaggaagg catatttgtc      1620
     tgtggcagtg cccagtcccc caaggacata acagactcaa tagcccaagc cgggcttgct      1680
     gcctcccgcg ctcatgcttt cctggcggca ggtgagatat atctggatcc gcatattgca      1740
     gttgcagacc ctgatgtgtg cactttatgc ggcaagtgtg taacatgtcc ctttggggcc      1800
     atttccatag aggataaggt aaaaatcgat ccgctcgtgt gtaatggatg tggctattgc      1860
     acctccctct gtgatgaaga tgcgatccat atcaggggct acagcaggga agaactggta      1920
     gccgagatag aaggtctggc tcaagcaggg gataccattg tctttgccag ctgcaacatc      1980
     gcatattcaa ccattgataa tataggaagt agtgcgcagg attatcctgc ttctacaaag      2040
     atcataaggg tgccgacaac taccattgtg acagcggaaa tgcttgatat ggcattcaat      2100
     aggggtgttt ttcatgttgt ttttgtggaa gaaccaccgg ataaccagat tggtgaaata      2160
     atctatccac tggctgaggc acggtttttt gaattaaaag cagaatatgg tgatcgattg      2220
     catctcaaga aggcttatat tcctcatgca aagggactca gtgatatgtt ctcttccctg      2280
     gaagaggtgg aagaatga                                                    2298
//

If you have problems or comments...

PBIL Back to PBIL home page