(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE409

CP001994.PE409       Location/Qualifiers
FT   CDS_pept        435815..436420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0416"
FT                   /product="Heterodisulfide reductase subunit C"
FT                   /note="COGs: COG1150 Heterodisulfide reductase subunit C;
FT                   InterPro IPR017900; KEGG: afr:AFE_2555 iron-sulfur
FT                   cluster-binding protein; SPTR: Q46B51 Heterodisulfide
FT                   reductase subunit HdrC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35947"
FT                   /db_xref="GOA:D5E9U6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U6"
FT                   /protein_id="ADE35947.1"
FT                   /translation="MNENHDTPECGSLVETVKKSLRTSDSIGIERCMQCGACTSSCPAA
FT                   RYSDYNPRNVMKRVKENDWSVIEDKTIWNCFYCYTCNLRCPRNNSPSQIVQVLRQMAIN
FT                   KGIGIERLSVLFEYPESFARLGISQIPAPYIGQMEEDLGKHWQHFRDNLEDIREELGLG
FT                   PLAIEDERGEIKALLKGIGFEDRFVRLKEMAAEEGEDE"
     atgaatgaaa atcatgacac tccggaatgt ggatctcttg tagaaaccgt caagaaaagc        60
     ctccggacct cggattctat cggtatcgag cgctgtatgc agtgtggtgc ctgtacttct       120
     tcgtgcccgg cggcacgata cagtgattac aatccccgca atgtaatgaa aagggtcaaa       180
     gagaacgatt ggagtgtaat tgaagacaag acaatatgga attgcttcta ttgctataca       240
     tgtaacctgc gctgcccgcg taacaacagt ccttcccaga ttgtgcaggt attgcgtcag       300
     atggcaatta acaaaggtat tggtattgag agattgagtg tgctttttga atatcccgaa       360
     tctttcgcca ggttgggtat cagccagata cctgcaccct atatcggaca gatggaggag       420
     gacctgggta aacactggca gcatttcagg gacaatctgg aggatatccg ggaggaactc       480
     ggcctgggtc ccctggccat agaagacgaa aggggcgaga tcaaagcgct acttaagggt       540
     atcgggtttg aggatcgttt tgtcaggctt aaggagatgg ctgcagaaga aggtgaggat       600
     gaatga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page