(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE412

CP001994.PE412       Location/Qualifiers
FT   CDS_pept        438683..438889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_13610 hypothetical protein; SPTR:
FT                   Q12TV1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35950"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U9"
FT                   /protein_id="ADE35950.1"
FT                   /translation="MEEINRDKLKHLLGHWIEHNENHCESFENWIPQLEDAGFQQAAEY
FT                   VSAASSEMEQSTDMLRKALESLE"
     atggaagaaa taaacaggga taaactgaaa catttgcttg gacactggat agaacacaac        60
     gaaaaccatt gtgaaagttt tgaaaactgg attccccagc ttgaggacgc agggttccag       120
     caggctgcag aatacgtttc tgctgcctct tctgaaatgg aacaatcaac agatatgttg       180
     agaaaagcac tggaatccct tgaataa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page