(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE413

CP001994.PE413       Location/Qualifiers
FT   CDS_pept        complement(438892..439392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0420"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006015:IPR006016; KEGG: sfu:Sfum_0624 UspA
FT                   domain-containing protein; PFAM: UspA domain protein; SPTR:
FT                   Q12Y07 UspA; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35951"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V0"
FT                   /protein_id="ADE35951.1"
FT                   /translation="MRSLPNVNIIYLHYYVMGNLMNNVKKILIATDGSEHSKKAASEGI
FT                   SLAKIYGARVFAVHVMKELSSKTLPYGARITNFDIPHEDIKREGQEALQYVEELGDPQG
FT                   VAVDTALLTGNPAEEILDFAKENEIDIIVMGSLGRTGLERYLMGSVSEKVLRHAKTAVM
FT                   VIP"
     atgaggagcc ttccaaatgt taatataatc taccttcatt attatgtaat ggggaattta        60
     atgaataatg taaaaaagat tttaattgca acagatggct cagaacactc caaaaaggcg       120
     gcatccgaag gaataagcct ggcaaaaatc tatggtgcaa gagtatttgc agtacacgta       180
     atgaaagaac tttcatcaaa aacccttcct tatggagcaa gaatcacaaa ttttgacatc       240
     ccccacgaag acataaaaag agaaggacag gaagcccttc agtatgtgga agaactggga       300
     gatccccagg gagtagctgt tgatacagct cttttgacag gtaatcccgc ggaggaaata       360
     ctggattttg caaaagaaaa tgaaatagac ataatagtta tgggctcact gggacgcaca       420
     ggcctggagc gctatcttat gggaagcgtt tctgaaaagg tcctaagaca tgcaaaaact       480
     gcggtaatgg taatcccttg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page