(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE415

CP001994.PE415       Location/Qualifiers
FT   CDS_pept        439800..440990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0422"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027; KEGG: dvm:DvMF_0624
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: A4WJC6
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35953"
FT                   /db_xref="GOA:D5E9V2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V2"
FT                   /protein_id="ADE35953.1"
FT                   /translation="MKERVLILGAGYAGAVIANTLAREFRRKIAKGELEITVLDKNDMG
FT                   VNQGGFTFLPFGLYTPEDLVRPRKESLSPRIKSRFGDQGEVTGIDLNRQQVTVKSGKNY
FT                   SYDHLVIAMGARSDASGVPGLEDDLNTFYTSMDDALEVGELIRNFKGGRIVVSVSRMPI
FT                   PCPGAPVKFSFLLESYLRDIRNIRDDVQLTLLWPMEPIGPPEFNKLVTGRLEEKGIEAI
FT                   RQFQLGKVDASNKMVESTDGRQENYDLLITVPPHKPQKAVLDSGLTDEKGWIDADKTTL
FT                   QYRGPLGDKDNVYIVGDNGPADILKTGIGAHYQAQVVSHNLINTINGNNIKSKYKGETG
FT                   CPIITDMASDAHTGRAYIATWSYKNPPQSFDTTQLGWYLYRMYYYLHWDMSIKALM"
     atgaaagaaa gagtactgat acttggagcc ggctatgcgg gtgcggtgat tgcaaacaca        60
     ctggcccgtg agttcaggcg caaaattgca aagggtgaac ttgaaattac agtgcttgac       120
     aaaaacgata tgggggtcaa tcagggtggt tttacttttc tgccctttgg tttatacacc       180
     cctgaggacc tggtcaggcc gaggaaagaa tcgttgagtc ccaggattaa gagtcgtttt       240
     ggggatcagg gtgaagtcac gggtattgac ctgaacaggc agcaggtaac tgtcaaatcc       300
     ggtaaaaatt attcatatga tcatcttgtg attgcaatgg gggcaagatc ggatgcttcc       360
     ggtgtgccgg gtcttgaaga tgatctcaat acattctata catctatgga cgatgccctg       420
     gaagtagggg aacttatccg caatttcaaa ggtggcagaa tagtggtttc ggtttccaga       480
     atgcctatac cctgcccggg tgcccctgtg aaattctcct ttttgctgga gagttacctg       540
     agggatatac gtaatatcag ggatgatgtg cagctgacgc ttctctggcc tatggaacca       600
     ataggtccgc cggagtttaa taaactggtt accggtcgtc ttgaagaaaa aggaattgag       660
     gccatcaggc agttccagct tggcaaggtt gatgcttcaa acaagatggt tgaatctacc       720
     gacggcaggc aggaaaacta tgacctgctt atcacagttc ctccacataa gccacaaaag       780
     gctgtactgg attcgggtct tacagatgag aaagggtgga ttgacgcgga taaaacaacc       840
     ttgcaatatc ggggtccgct cggggataag gataatgtgt acattgtggg ggacaatggt       900
     ccggccgaca tcctgaaaac aggaatcggt gcgcactatc aggcacaggt ggtatcccac       960
     aatctgatca atacgatcaa tggcaacaat atcaaatcga agtacaaggg tgagaccggc      1020
     tgcccgataa ttacggatat ggcctctgat gctcataccg gtagagcata cattgctacc      1080
     tggagttaca agaacccgcc ccagtcgttc gataccactc agcttggctg gtatctgtac      1140
     cggatgtatt actacctgca ctgggatatg agtataaagg cattgatgtg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page