(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE416

CP001994.PE416       Location/Qualifiers
FT   CDS_pept        441001..441366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0423"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="InterPro IPR012440; KEGG: dma:DMR_13130 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1641; SPTR:
FT                   Q4JBT0 Conserved protein; PFAM: Protein of unknown function
FT                   (DUF1641)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35954"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V3"
FT                   /protein_id="ADE35954.1"
FT                   /translation="MAEDIKNVNIGMTQADIDAFVDIVRTARIMQSYLNDETVHGVANV
FT                   MTPMLKLLNGVASTDLVDVLERSMQDPGLDKALMNPPKVGMYGALREMGDEDFQKGLGI
FT                   AIEFLKALGRASEDIGE"
     atggctgaag atataaagaa tgttaatata ggaatgacac aggcagacat cgacgccttc        60
     gtggatattg tcaggactgc ccgtatcatg cagagttacc ttaatgatga aacggtccac       120
     ggcgttgcaa atgtgatgac acccatgcta aaactgctca acggagttgc cagtacagat       180
     cttgtggatg tactggaaag gagtatgcag gatcccggtc tggacaaggc tttgatgaac       240
     cctcctaagg ttggtatgta tggtgcactt cgtgagatgg gagatgagga tttccagaaa       300
     gggttgggga tagccattga attcctgaaa gcccttggca gggcttcgga ggatataggg       360
     gaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page