(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE418

CP001994.PE418       Location/Qualifiers
FT   CDS_pept        complement(442071..445061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0425"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG4548 Nitric oxide reductase activation
FT                   protein; InterPro IPR002035; KEGG: dol:Dole_3133 von
FT                   Willebrand factor type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: Q8PST9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35956"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V5"
FT                   /protein_id="ADE35956.1"
FT                   /translation="MPADKKSPAIRNKRVANTYEKTKTELIPLMDEEVFHLWQSVINIL
FT                   AEKEIKCAIEFTRKTKIVFPVIPSWQRLKLLITTQKFAAKYPRTSLVFFTDAPLAMASL
FT                   DKAGSLDKTGFERWETTALKLAEKEEDVAIIFIQRTSRLLNDLDLDEILDWVERGSELF
FT                   STRPEAVELFFEGTFNGLANHIGKTSRKQRKCLFERGFKLALTNHRCVQSYFEKSPPVI
FT                   TELPKDEFTKWANTGEKIAEGSTFYCREYYNNSFTTLKRINPLFYDLIFNNAQSLLKKE
FT                   QLLAGIYFSKLQEILLSIHPEELKTWVNTGIKLFEKDREIAIQYFRNSAILLQDLEITE
FT                   LEEWAMKGLEIFENNSAGARLYFSLKSKKSREFIEYLMSGVALKRVNNILTYYALGISG
FT                   INFNIRSRNLLPEDHVDSIQPVVSGKTIYLVPTMKGYGDFEDNFMIYKLSVMHEVGHQK
FT                   FGTTGYATKSFLPLLNKTSTNINSTHLEKIVASGDDKDNTVSLKDIISLFPQPSLAADI
FT                   MGIVEDARIEYMITRVYRGLRRDFERVREKMVRNRKVPQNRTGIFMEALLLLSVDQEPP
FT                   LVIDEVTKDLLEKARVLLDLKIFQPQSLTIDSLEVTFEIYEMLEKSILPENPRQYTSIQ
FT                   NLEYRGVGPGLHSENETEGNAGKALERFIPLTEWELAENEIIQENIQAGPKCALAKNWE
FT                   VLSSFTYDEWDSRLRDYKSGWSTVYEVCPTGKSTDFYRDTLQNYIHEISLIKRIFRMMK
FT                   PVSFRKLRRQSDGDEIDFDAIVEAFTDRKCGINPTERLYIRRDKRERDVATLFLVDISA
FT                   STRKKLDNSKSILDVEKEALVLMTEALESIGDKYAIYAFSGDTRNDVEYYTIKDFGEVF
FT                   SENVECKIDALEPADNTRLGPVIRHSITKLKEIDAKIKLLVLLSDGEPYDFGIADGKYE
FT                   NEVAIEDTKMAIQEGKALGMHFFCITVDSKASDYMHSIFSDVGYTIIDNATTLPERLPM
FT                   LYNRLTT"
     ttgcctgcag ataagaaaag tcctgcaatc aggaacaaga gggttgcaaa tacatacgag        60
     aaaacaaaaa cagaattaat acccctgatg gatgaggaag tttttcattt atggcaatca       120
     gtgataaata tcctggctga aaaagaaata aaatgtgcta ttgaatttac ccgaaaaaca       180
     aaaattgttt tccctgtaat tccttcctgg caacgtctta aactgcttat cacaacccag       240
     aagttcgctg ccaaatatcc ccgcacatcc ctcgtcttct ttactgatgc tcctcttgca       300
     atggccagtc ttgataaagc aggcagtctt gataaaacag ggtttgaaag atgggaaact       360
     acagcattaa aactggccga aaaggaagaa gatgttgcaa taatattcat tcaaaggaca       420
     tccagattac taaatgattt ggatctggat gagatactgg attgggttga aagaggcagc       480
     gaactttttt ccacccggcc agaagctgta gaattattct ttgagggaac attcaatggg       540
     cttgcaaatc acataggaaa aaccagcaga aaacagagga aatgtttgtt tgaaaggggt       600
     ttcaaacttg cacttacaaa tcacaggtgt gtgcaaagct attttgaaaa atctcctcct       660
     gtaatcacag aacttccaaa ggatgaattt acaaaatggg caaacaccgg tgaaaaaata       720
     gcagagggga gtacttttta ctgcagagaa tattacaata actcctttac caccctaaaa       780
     agaataaatc ctctattcta tgatttgatc tttaataatg cacaatccct gctgaaaaaa       840
     gagcaattgc ttgcaggaat ttatttttca aaactccagg aaatcctgct gagcattcat       900
     cctgaagaac taaaaacctg ggttaacacc ggcatcaaat tatttgaaaa agaccgggaa       960
     atagcaatac agtatttccg caattctgcc atcctgctcc aggacctgga aataaccgaa      1020
     cttgaagaat gggcaatgaa aggtcttgaa atttttgaaa ataattctgc aggagcaaga      1080
     ttgtatttct cccttaaatc aaaaaaatcc agagaattca tagaatattt gatgagcgga      1140
     gttgctctta aaagagttaa caatatcctg acatattatg cattaggtat ctcaggaata      1200
     aattttaaca ttcgctccag aaatctcctg ccagaagacc atgtagattc catacaacca      1260
     gtagtttccg ggaaaaccat ctaccttgta ccaacaatga aaggatacgg ggattttgaa      1320
     gataatttca tgatctacaa actaagtgta atgcatgaag tagggcacca gaaatttggc      1380
     actacaggat atgcaacaaa atcatttcta ccattattaa acaaaacatc aacaaatatt      1440
     aattctacac acctggaaaa aattgttgct tctggagatg acaaagataa cacggttagt      1500
     cttaaagata taatcagcct gtttccgcaa ccatctcttg cagcagatat catgggaatt      1560
     gtagaggatg ccagaatcga gtatatgata accagggttt acaggggttt gcgccgggat      1620
     tttgaaagag tcagggaaaa gatggtaaga aacaggaaag taccacaaaa ccggactgga      1680
     atattcatgg aagcccttct tttattatct gtggaccagg agccaccatt ggtaattgat      1740
     gaagtcacca aagatcttct ggaaaaagcc agggtcctcc tggatttgaa aatattccag      1800
     cctcaatctt taaccattga ctctctggaa gttacatttg aaatatacga aatgcttgaa      1860
     aagagtatcc ttcctgaaaa tcccaggcag tataccagca tacaaaacct tgagtaccgg      1920
     ggtgtcggtc ccggactaca ttctgaaaat gagactgagg gaaatgcagg aaaagcatta      1980
     gaacgcttta tacctctgac agaatgggag cttgctgaaa atgagatcat acaggaaaac      2040
     attcaggcag gaccaaagtg tgccctggca aaaaactggg aggtacttag cagttttacc      2100
     tacgatgaat gggatagcag gttgagggat tataaatccg gatggagtac cgtatatgaa      2160
     gtctgtccga ctggtaaatc caccgatttt taccgggaca ccctacagaa ctacatccat      2220
     gaaatttcac tcataaaacg tatattcagg atgatgaaac cggtttcatt tcgtaagtta      2280
     agaagacaaa gcgatgggga tgaaatcgat ttcgatgcga ttgtcgaagc tttcacggac      2340
     agaaaatgtg gtataaatcc cacagaacgc ctctatatac gccgggacaa acgtgagagg      2400
     gatgttgcca cactttttct tgttgacata agtgcatcca ccagaaaaaa actggataat      2460
     agcaaaagca tactggatgt agaaaaggag gcacttgtcc tgatgacaga ggccctggaa      2520
     agcatcgggg ataaatatgc gatctatgct ttttccggcg ataccagaaa tgatgtggaa      2580
     tactatacca taaaagattt cggggaagtt ttttcagaaa atgttgaatg caaaatcgat      2640
     gcactggaac ccgcagataa cacccgtctg ggtcctgtaa tcagacattc cataactaaa      2700
     ctgaaagaaa ttgatgcaaa aattaaactt ttggtattat tatccgacgg tgaaccctat      2760
     gattttggga ttgcagacgg gaaatacgag aatgaagttg caattgaaga tacaaaaatg      2820
     gcaattcagg aaggaaaagc ccttggaatg cactttttct gtataaccgt tgattcaaaa      2880
     gcaagcgatt atatgcattc gatattttcc gatgtgggtt ataccattat tgataatgca      2940
     actacccttc ctgaaagact tcccatgctc tataacaggc tcaccacctg a               2991
//

If you have problems or comments...

PBIL Back to PBIL home page