(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE419

CP001994.PE419       Location/Qualifiers
FT   CDS_pept        complement(445069..445893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0426"
FT                   /product="CbbQ/NirQ/NorQ domain protein"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR013615:IPR011704; KEGG: neu:NE1919 nitric oxide
FT                   reductase NorQ protein; PFAM: CbbQ/NirQ/NorQ domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SPTR: Q8PST8 Conserved protein; PFAM: AAA domain
FT                   (dynein-related subfamily); CbbQ/NirQ/NorQ C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35957"
FT                   /db_xref="GOA:D5E9V6"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V6"
FT                   /protein_id="ADE35957.1"
FT                   /translation="MKAISYQEQPVEEYVIREKPYYVPVKDEVEIFTAAFENNLPVNLK
FT                   GPTGCGKTRFMEYMAYKLERPLITIACHEDLTASDLIGRFLIKNESTQWNDGPLTKAVK
FT                   NGAICYLDEFVEARMDTRVVIHPLTDDRRVMPIDKLGIILHAPPEFMLTISYNPGYQSV
FT                   LKDLKQSTRQRFVAIDFDYPPADTEYEIVAHESGIDMEDARTLVDIGQKIRNFKQHGLE
FT                   EGVSTRLLIYAGMLIRSGIDQKEACRAAMIKPITDDYELQKSIDEIITAIVE"
     atgaaagcga taagttacca ggagcagcct gttgaagaat acgtcatcag agaaaagccc        60
     tattacgtcc cggtaaaaga tgaagttgaa attttcaccg ctgcttttga aaacaatctg       120
     cccgtcaacc tgaaaggacc tacaggttgc gggaaaaccc gttttatgga atacatggcg       180
     tacaaattag aacgtcctct tataacgata gcctgccatg aagaccttac agccagtgat       240
     cttatcgggc gattcctcat aaaaaacgaa tctacccagt ggaacgacgg ccccctcaca       300
     aaagctgtca aaaacggtgc catctgttac ctggatgaat tcgtggaagc caggatggac       360
     acaagggttg tgatacatcc ccttactgac gacaggcggg taatgccaat agataaactg       420
     gggataatac ttcatgctcc tccagagttc atgttaacta tttcctacaa ccctggctac       480
     cagagtgtct tgaaagacct caaacagagc acccgccaga gattcgttgc catagacttc       540
     gattacccgc ctgcagacac agaatatgaa attgtggcac atgagagcgg aattgatatg       600
     gaagacgccc ggactcttgt ggatatcggc cagaaaatca ggaacttcaa gcaacatggg       660
     cttgaagagg gagtaagtac acgcctgtta atctatgcag gtatgcttat ccgttctggc       720
     attgaccaaa aagaggcttg cagggcggca atgatcaaac ccataactga tgattacgag       780
     ctccagaaaa gcattgatga aataataacc gctattgtgg agtga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page