(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE421

CP001994.PE421       Location/Qualifiers
FT   CDS_pept        complement(446926..449307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0428"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR003018:IPR013767:IPR
FT                   013656:IPR003594:IPR003661:IPR001610:IPR000014:IPR000700:I
FT                   PR005467; KEGG: pmy:Pmen_0835 multi-sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-3 domain protein; GAF domain protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: Q8TPF6 Sensor protein; TIGRFAM: PAS sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35959"
FT                   /db_xref="GOA:D5E9V8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V8"
FT                   /protein_id="ADE35959.1"
FT                   /translation="MMVMRGYFQKSFLDKISEGYAYNRIILDENGVPCDYEFLEVNAAF
FT                   EKQTGLKCSDIIGKKATEVLPWIQDYSFDWIKFCGDIALNGRDEKNKTIFHPLSRWYKV
FT                   HVYSPEKYLFVTLYTDLSKDEEIFHRLNDNSQDIIFRYELSPVRGFTYVNNAAASIIGY
FT                   TPEEYYDDPDMCLKIIHPDDRKLLGDCVQGKIPLHKPIVLRYIHKNGQTVWIEQRNLPT
FT                   YDTNGNLIALEGIGRDITERKQAEDNIYNGYVRESAINEILRLSFKDLPIERLLEKALN
FT                   LILDIPDFELENAGAVFLVEDDADCLVLKASHGLADPLLRKCARVPFGKCLCGRAASTE
FT                   KMIFADRVDECHDIHYEGMKPHGHYCTPLRFKNQTIGVLNLYVQEGHTYSAKLEQFLVS
FT                   SANALSGIIARKKAEEDINHYAGMITSLLDSIPDIIFFKDVKGVYMGCNPAFTEFVGRP
FT                   REEIIGKTDYDLFDKAFADFFRKHDERTLELLQPRHNEEWITYPDGRKILLDMLKTPYR
FT                   GPDGLLIGILGIGRDITERNRAEQALLKGKLIAEENDRMKSEFITNMSHELRTPLNSVI
FT                   GFSDVLLKEIKGELNDSQKKYISNISKSGRHLLELINDILDLSKIEEGKMELQCEDFDL
FT                   NSILSEVESIFSPQAAKKDINLQFVLSEKIPRIKGDKIKIKQVIFNLLTNAIKFTPKNG
FT                   AISVIAKENDDNIIEVSVSDTGIGIPEAKLEDVFDPFIQVDASTSRNYGGTGVGLSLAK
FT                   KFVQMHDGKFCVESEVYKGSTFTFTIVNQEYTSQSSYSKQ"
     atgatggtaa tgagaggtta ttttcaaaaa tcatttctgg ataaaatttc cgagggatat        60
     gcatataatc gaattatttt agatgaaaac ggagttcctt gtgattatga atttcttgaa       120
     gtaaatgctg cttttgagaa acagactggg cttaaatgtt cagacattat tggaaaaaaa       180
     gcaaccgaag tacttccttg gattcaggat tactcttttg actggattaa attttgtggt       240
     gatattgcct taaatggacg ggatgaaaaa aataaaacaa tttttcaccc tcttagtaga       300
     tggtataagg tgcacgtata ctcgcctgaa aaatatcttt ttgttacact ttataccgat       360
     ctatcaaaag atgaggaaat attccaccgc ttgaacgata attcacagga cattatattt       420
     cgttatgaat taagtcccgt acgtggattt acgtatgtaa acaacgctgc agcctcaata       480
     attggttata ctcctgagga gtattatgat gatcccgata tgtgtttaaa aatcatccat       540
     ccggatgata ggaaattgct tggagattgt gttcaaggaa aaattcccct acataaacct       600
     attgtgttgc gttacattca caaaaacggt cagacagtat ggatcgaaca acgaaatctg       660
     ccaacttatg atacgaacgg aaacctgatc gcattggaag gtattgggcg ggacattacc       720
     gaacgcaagc aggcagaaga taatatatat aatggatacg tgcgtgaatc cgccatcaat       780
     gaaatccttc gcctgtcctt taaagattta ccgatcgaac gtctgcttga gaaggctttg       840
     aatttaattc ttgacatacc tgatttcgaa cttgaaaatg ctggggctgt tttcctagtg       900
     gaagatgatg cagactgcct ggtacttaag gcttcacatg gactagctga cccactttta       960
     cgtaaatgtg cacgcgtgcc ttttggaaaa tgcctatgtg gacgtgccgc atccaccgaa      1020
     aaaatgatat ttgccgacag agttgatgaa tgccatgata tccattatga aggtatgaaa      1080
     cctcacggac actattgcac cccattgcga ttcaaaaacc aaactatcgg tgtcttgaat      1140
     ctttacgtgc aagaaggtca tacctactct gccaaactgg aacagtttct cgtcagctcg      1200
     gcaaacgccc tgtcaggaat tatcgcacgc aagaaagccg aagaagatat caatcactat      1260
     gctggtatga ttacatccct actagattcc attcccgata ttattttctt caaagatgtg      1320
     aagggagttt atatgggatg caatcccgca tttaccgagt tcgtaggtag gccaagagaa      1380
     gaaatcatcg gtaaaaccga ttacgacctc ttcgacaagg ctttcgcaga ttttttcaga      1440
     aaacatgacg aaaggacact ggagttgctg caaccccggc acaacgagga atggattaca      1500
     tatcctgatg gaagaaaaat attgctcgac atgctgaaaa caccatacag aggaccagat      1560
     ggcttattaa ttggtattct cggaattggt cgtgatatca ccgagcgcaa ccgtgcagaa      1620
     caagctttac tcaaaggtaa attaatagca gaagaaaatg accgtatgaa atcagagttc      1680
     attacaaata tgagccatga gctgcgtaca cctttaaatt cagtaattgg tttttccgat      1740
     gtactattga aagaaataaa gggagaactc aatgattcac agaaaaaata tatttccaat      1800
     atttccaaaa gtggcagaca cctgcttgaa cttataaatg atatcctgga tctttcaaaa      1860
     atagaagaag gcaaaatgga gcttcagtgt gaagatttcg atcttaattc tattttaagt      1920
     gaagtagaat ctatattttc acctcaagca gctaaaaaag atataaatct acaatttgta      1980
     ttatctgaaa aaatcccaag gatcaagggt gataaaatca aaatcaaaca ggttatattc      2040
     aatctactga ccaacgctat aaaattcact ccaaaaaatg gtgcaatttc agtgattgca      2100
     aaagaaaatg atgacaatat aatagaggtg tctgtttctg acactggaat tggaatccct      2160
     gaagccaagt tagaagatgt atttgatcca ttcatacagg ttgatgcgtc cacatcccgg      2220
     aactatggag ggactggagt ggggctttct ctggcaaaaa aatttgttca aatgcatgat      2280
     ggaaaattct gtgtggagag tgaagtctac aaaggaagta cttttacgtt tacaattgtt      2340
     aatcaagagt atacttcaca gagttcctac tctaaacaat aa                         2382
//

If you have problems or comments...

PBIL Back to PBIL home page