(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE422

CP001994.PE422       Location/Qualifiers
FT   CDS_pept        449779..449928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35960"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V9"
FT                   /protein_id="ADE35960.1"
FT                   /translation="MRPVLHTTVGQRTAYIIHRVMKEKKCKKSEVLDYIVAEYEIRKGG
FT                   RACR"
     atgaggccgg tacttcatac aactgtaggt cagcgtacgg catacattat ccacagagtc        60
     atgaaagaaa agaaatgcaa gaagagtgaa gtgctcgatt atattgttgc cgagtatgag       120
     atacgcaaag ggggccgagc ctgtagatga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page