(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE425

CP001994.PE425       Location/Qualifiers
FT   CDS_pept        complement(454817..455563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0433"
FT                   /product="protein of unknown function DUF541"
FT                   /note="COGs: COG2968 conserved hypothetical protein;
FT                   InterPro IPR007497; KEGG: rpb:RPB_0357 hypothetical
FT                   protein; PFAM: protein of unknown function DUF541; SPTR:
FT                   Q8TTW4 Outer membrane protein; PFAM: Protein of unknown
FT                   function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35963"
FT                   /db_xref="GOA:D5E9W2"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W2"
FT                   /protein_id="ADE35963.1"
FT                   /translation="MSPENGKDKLYYVVIALSAVLILMAATLYAGSVGSSDRSSENTMH
FT                   MSGNSEMMVVPDTATLNIGAEVMAPTAEEASQENAAIMNAVIEELKNIGLEEEDIQTSR
FT                   VSVRPVYNYEERTRTIEGYSASNNVQITTTMLDSLGEMIDRSASAGANQIGGISFTVSD
FT                   DKQKELREDLISEAVADASSKAEILAENLGVEIISVKSSSISDNNQPRIFYEEVAEEIE
FT                   KESGPTPIEPGESKISMSVQVTYITQ"
     ttgtctccgg aaaatggtaa agataaatta tattatgtcg taattgcact atccgctgtt        60
     ctgatactaa tggctgcaac tttatatgca ggatcggtgg gttcatcaga tagaagttca       120
     gaaaatacta tgcatatgag cggcaattca gaaatgatgg ttgtaccgga cactgcaact       180
     ctgaatattg gtgcagaggt catggccccc actgcagaag aagcgagcca ggagaacgca       240
     gctatcatga atgcagttat tgaggaactt aaaaatattg gtctagagga agaagatatc       300
     cagacctcac gcgtttctgt acggcctgtg tacaattatg aagaaaggac acgaacaatt       360
     gaagggtatt cagcttccaa taatgtgcag ataactacta caatgcttga tagtctggga       420
     gagatgattg acaggtcagc atctgcaggc gctaatcaga taggaggtat atcctttact       480
     gtatctgatg ataaacagaa agaattgcgt gaagacctga tcagtgaagc tgtggccgat       540
     gcatcatcaa aagctgaaat actggctgaa aatctgggtg tagagatcat aagtgtgaag       600
     tcatcatcta taagcgacaa taaccagcca aggatatttt atgaagaagt tgcagaagaa       660
     atagagaaag aatcaggacc aacaccgatt gaaccgggag agtctaagat ttcgatgtca       720
     gttcaggtca cttacattac tcaataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page