(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE427

CP001994.PE427       Location/Qualifiers
FT   CDS_pept        456435..457037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0435"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   geo:Geob_1876 class II aldolase/adducin family protein;
FT                   PFAM: class II aldolase/adducin family protein; SPTR:
FT                   Q12U01 Class II aldolase/adducin-like protein; PFAM: Class
FT                   II Aldolase and Adducin N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35965"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W4"
FT                   /protein_id="ADE35965.1"
FT                   /translation="MAHKFYGWLNLYLTPMWQEMARIGKKLVDHGLVESHFGNISVRQG
FT                   NSMVITRSGCPLDEICEENVVEVPIHNTCEFDGLASSETRVHRRIYQETDAGCIVHGHC
FT                   PFAVVMSLLDESGSIEPLDSEGVYFLGHVSIVEGSIGSEELAANSAAALAETNGVIVKS
FT                   HGTISTGKTLDHAYINTTQIEHTCKVRYYYDLAKRSL"
     atggcacata aattttatgg ctggttgaac ttatatctaa ctcctatgtg gcaggaaatg        60
     gcaagaatcg ggaaaaaact cgtggatcat gggctggttg agtctcattt tggaaatata       120
     agtgtacgtc agggcaacag tatggtgata acccgcagtg gatgcccgct tgatgagata       180
     tgtgaggaga atgtggtgga ggtgcccatc cataacacct gcgaatttga cggtctcgca       240
     tcgtcggaaa cccgggtcca caggcgtatc tatcaggaga ctgatgccgg atgcatcgtg       300
     cacggccact gtccctttgc agttgtgatg tcactgctgg atgaatcggg cagtatcgaa       360
     ccactggata gtgaaggtgt gtatttcctg gggcatgtgt cgattgtgga aggcagtata       420
     ggcagtgaag aacttgccgc aaactccgct gcggcgctag cagaaaccaa cggggttatc       480
     gtcaaaagcc acggcaccat ctccacagga aaaaccctgg accatgccta catcaacacc       540
     acccagatag agcacacctg caaagtgcgc tattactacg atcttgctaa aagatccctg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page