(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE43

CP001994.PE43        Location/Qualifiers
FT   CDS_pept        47723..48499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0044"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR004033:IPR013217; KEGG: sme:SM_b20059
FT                   SAM-dependent methyltransferase; PFAM: Methyltransferase
FT                   type 11; UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 12; SPTR: Q8TIA7 Phosphatidylethanolamine
FT                   N-methyltransferase; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35581"
FT                   /db_xref="GOA:D5E8S2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S2"
FT                   /protein_id="ADE35581.1"
FT                   /translation="MTVKQQIEEYWDWRSTSYTNGATSLGEEERELWKQSLFPYLGQGP
FT                   LKVLDIGTGRGFLALLLADMGHEVTAIDISQSMLEKAQREAIKLNLDIKFEKGDAENLA
FT                   FADSSFDVVVSKYLLWTLPEPENTLKEWRRVLLPEGKIIAIDGNWFDPSPVKKFKRRIR
FT                   KILQGITHRDPTTGVLRQGKFNQYYSPLHASLPLYSNVKPESIRPLFEKAGFEDMQIDS
FT                   LPLIHKYNLKNMHPLLRPLNTDTFFLISGTSSKQDK"
     atgactgtaa aacagcagat agaagaatac tgggattggc gcagtacaag ttacactaac        60
     ggcgccacat ccctgggaga agaagaaagg gagctctgga aacagagtct ttttccctat       120
     ctgggccaag gtccgctaaa agtacttgat ataggtacag gcaggggttt tctggctctt       180
     ctacttgcag acatgggaca tgaggtaact gctattgata tatcacaatc catgctggaa       240
     aaagcgcaga gagaagctat aaaactcaat ctggacataa aatttgaaaa aggagatgca       300
     gaaaatctgg catttgcaga ttcaagtttt gatgtagtgg taagtaaata tcttctctgg       360
     acccttcccg aaccggaaaa tacgcttaag gaatggagac gtgtcctgct tccagaagga       420
     aagattattg cgattgatgg aaactggttt gatccatcac ctgtaaagaa attcaagcgc       480
     aggattagaa aaatactgca gggtataaca cacagggacc ctacaacagg agtgttgcgt       540
     cagggcaaat tcaatcaata ttattcccct ctacatgctt ccctgcccct ttattcaaat       600
     gtaaagcctg aaagtatcag gccactcttt gaaaaagcag gttttgagga tatgcaaatt       660
     gattcgttac cattgataca caaatataat ttgaaaaata tgcacccact actgagacct       720
     ctgaatacag atacattctt cctgatatcc ggtacttcct ctaagcagga taaatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page