(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE432

CP001994.PE432       Location/Qualifiers
FT   CDS_pept        460449..461294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0440"
FT                   /product="acyltransferase"
FT                   /note="COGs: COG4801 acyltransferase; InterPro IPR001451;
FT                   KEGG: gsu:GSU2266 UDP-3-O-3-hydroxymyristoyl glucosamine
FT                   N-acyltransferase; SPTR: Q12U06 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function, DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35970"
FT                   /db_xref="GOA:D5E9W9"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W9"
FT                   /protein_id="ADE35970.1"
FT                   /translation="MEEHNIVLDEDIIVGNHSDIRYGIIADSVIIGERVSVSGDVLARS
FT                   DIRIDIWSKIGGNVRCGENGYIGEFVKIDGKLFVNGDLDVGNDVKINRGFEAHGWIVVR
FT                   NPVPVITYIFLYISELLRMGKGEEVERAMSEFFEEEAKEISYGAMVVPNGSRISADSIR
FT                   VPGTATIGNNCRLVGNIRAESLEMGDATTLYGSIRTASDIEIGENNAIHGNIVSRGRVI
FT                   VGKGTHILGEINAYSIRIHEDSRVDGVMRATGGTTFIREEEEVAQDRELIKLDVADQQQ
FT                   "
     atggaagaac ataatattgt tctggatgag gatattatag tagggaacca ttccgatata        60
     cgctacggta taattgctga ttcggtgata atcggagaaa gggtgtcggt atcgggtgat       120
     gtacttgcca ggtctgatat tcgtatagac atctggtcaa aaatcggtgg caatgtacgc       180
     tgtggcgaaa atggttatat tggcgaattt gtgaaaatag atggcaaact tttcgtcaat       240
     ggagatcttg atgttggtaa tgatgtgaag atcaacagag gtttcgaagc tcatggctgg       300
     atagttgttc gtaatcctgt acctgtaatc acctatattt tcctctatat ctccgaactt       360
     ttacgtatgg gtaagggtga agaagtagaa agggctatga gtgaattctt tgaagaggaa       420
     gcaaaagaga tcagttatgg tgctatggta gttcccaacg gatcccgcat atctgcagac       480
     tctataaggg ttcctggtac agccaccata ggtaataact gcaggctagt aggtaatata       540
     agggctgaat ctttggaaat gggcgatgct actactttgt atggaagtat caggacagcc       600
     agtgatattg agataggtga aaataacgcc attcatggta acattgtctc ccggggtagg       660
     gttatagtgg gtaaaggtac ccatatattg ggagagatca atgcttactc tatcaggatc       720
     cacgaggatt caagggttga tggtgtgatg cgtgccaccg gtggcaccac attcatacgt       780
     gaggaagaag aggtcgccca agacagggaa ctgataaaac tggatgtagc agaccaacag       840
     caataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page