(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE434

CP001994.PE434       Location/Qualifiers
FT   CDS_pept        462459..463544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0442"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839:IPR000277:IPR001917:IPR005861; KEGG:
FT                   dol:Dole_1983 histidinol-phosphate aminotransferase; PFAM:
FT                   aminotransferase class I and II; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: Q12U08
FT                   Histidinol-phosphate aminotransferase; TIGRFAM:
FT                   histidinol-phosphate aminotransferase; PFAM:
FT                   Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35972"
FT                   /db_xref="GOA:D5E9X1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X1"
FT                   /protein_id="ADE35972.1"
FT                   /translation="MAIYELVKPEIRSIAPYVPGKSIAEIAEKYNLESDSIIKLGSNEN
FT                   PLGPSPAAVSALQEAAATVNIYPSADARELVDAISAYVGMPQANIVASGPGMDGLLDGL
FT                   MRMLMSADSEVVVTTPTFSYYEISATACGAKPVFVKRNENFDVDIDRVIAAVNENTKVV
FT                   FICSPNNPTGNITAEKELRRLLDSVECLVFVDEAYVEFAGSDIASLVGEYDNLVVGRTF
FT                   SKAFGLAGLRLGYGIMPAWLKVEYMKAATPFNVSAPAVAAGIAALSDREHLEASQQMVI
FT                   DGREYLQANLPFKVYGSQANFMLVDVAPNSAKDVCDHLLRRGIIVRDCTSFRDAGDSFI
FT                   RVTVGTEEQNARIVEGFSTYL"
     ttggcaattt atgaactggt aaaacctgag atcaggtcga tagctcccta tgtaccgggc        60
     aaatcgattg ccgagatcgc tgaaaaatat aatctggaaa gcgattcgat tatcaaatta       120
     ggctcaaacg aaaatcctct gggaccttct ccggcagcag tcagtgcctt gcaggaagct       180
     gccgccactg tgaatattta cccttcggca gatgccaggg aactggtgga tgcgatctct       240
     gcttatgttg gtatgcccca ggccaatatt gtggcatccg gtccgggtat ggatggtttg       300
     cttgacggcc tgatgagaat gctcatgtct gcagactcgg aagttgtggt tacaactcca       360
     accttttcct attacgagat ttctgcaacc gcatgtggag caaaaccagt gtttgtgaaa       420
     cggaatgaaa attttgacgt ggatattgac agggtcattg ctgcggtaaa tgagaacaca       480
     aaagtagttt tcatttgctc cccaaacaat cccacgggca atatcactgc tgaaaaagaa       540
     ctacgcaggt tgctggattc ggttgagtgc ctggtttttg tggacgaggc ctatgtggaa       600
     tttgcaggtt cggatattgc atctcttgta ggggaatatg ataatcttgt tgttggcagg       660
     accttttcca aagcattcgg gctggcaggt ttgagacttg gctacggcat aatgcctgcc       720
     tggcttaagg tcgaatatat gaaagctgct actccattca atgtaagtgc accggccgtt       780
     gcagcaggca ttgctgccct ttctgacaga gagcatctgg aggccagcca acagatggta       840
     atcgatggtc gtgagtattt gcaggcaaat ctgcctttca aagtatatgg gtcacaggct       900
     aattttatgc ttgtggatgt tgcgcccaac agtgcaaagg atgtatgtga ccatctgttg       960
     cgcaggggga taattgtcag ggattgtact tctttccgtg atgcagggga ttcctttatc      1020
     agggtcactg taggtacaga agaacaaaat gcaagaattg tggaaggctt ttcaacctat      1080
     ttatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page