(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE437

CP001994.PE437       Location/Qualifiers
FT   CDS_pept        464668..465963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0445"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018486:IPR006025; KEGG: AAL127Wp; SPTR:
FT                   Q12YY9 Putative uncharacterized protein; PFAM: Peptidase
FT                   family M1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35975"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X4"
FT                   /protein_id="ADE35975.1"
FT                   /translation="MESGHYSFTSIVFYSLISVTLFCVLATSQASADWGQNEVEVNSVY
FT                   EVGCGVVHVSKEITFTNMDENTRYWQGFYSSLNYPVAPGHSNLSSFDDSSEIKSKRAED
FT                   GGNYYMFTFNENVWYGDSYILTLEYDVRMDPIYTTFTIREQSDSGNVKLIVPDNYEAYL
FT                   EDVDYAKENLDDHAVYTFDNKSFQEFPLRIDCVKTVDTMVDSEIVSLEGRNVSISVEYR
FT                   QGNDEWAQNVLDKTATYLPLLEDVWGAPYPGNSYLTIRESSIAETKGYDGFNYGNGTIS
FT                   LLHSAGDRVLIHELSHSWTHACNFEQLWMHEGYANLYTFLVLKQTNPEKALTMKSELED
FT                   GYGKNGHNFVQALDGWSIPDEYNTSSSESIGYGYSKSFVFVSDIYENVGFERMQIANRK
FT                   LLATGNVDTSDHISIIESVSGKEFDEMYSNFV"
     atggaatcag gacattattc ttttaccagc attgtatttt attctcttat ttctgtgact        60
     ttgttttgtg tgctggcaac ctctcaggct tcagcggact gggggcagaa tgaagtggaa       120
     gtgaattcag tatatgaagt aggctgcggg gttgtccatg tctcaaaaga gataactttt       180
     accaatatgg atgaaaatac ccgttactgg cagggatttt actcttcact aaattatcct       240
     gttgccccgg gtcattcgaa tcttagttcc tttgatgatt cttctgaaat aaaatccaaa       300
     agagctgagg atgggggaaa ctattacatg tttacattca atgagaatgt atggtatgga       360
     gatagttaca ttttaacact ggaatatgat gtaaggatgg accccatcta taccactttc       420
     acaatacggg aacaatcgga ttctggaaat gtgaaactca ttgtcccgga taattatgag       480
     gcatatctgg aagatgttga ctatgcaaaa gaaaatctgg acgatcatgc agtttatacg       540
     tttgataaca aaagtttcca ggaatttcct ttgcggatag attgtgtaaa aacagtggac       600
     accatggttg acagtgaaat tgtttccctg gaaggcagga atgtcagcat cagtgttgaa       660
     taccggcaag gaaatgatga atgggcacag aatgtgctgg acaaaacggc tacatatctt       720
     cccttgctgg aggatgtctg gggagctcct tacccgggca attcatatct cacaataagg       780
     gaatcctcaa ttgcggaaac caaaggctac gatggtttca attatggtaa tggtacgata       840
     tcccttctac actcagcagg agaccgtgtg ctgatacatg agctttccca cagctggacc       900
     catgcatgca attttgagca actctggatg catgaaggtt acgccaatct gtatactttc       960
     ctcgtgttaa aacagacaaa tccagaaaaa gccctaacta tgaaatccga acttgaggat      1020
     ggctatggta aaaatgggca caattttgta caggctcttg atggctggtc gattccggat      1080
     gaatataaca cttccagctc agaatcaatt ggatatggtt acagtaaatc ttttgttttc      1140
     gtatcagata tttatgaaaa tgttggattt gagaggatgc aaatcgccaa caggaagttg      1200
     ttggccaccg ggaatgtgga tacttctgat catatttcaa taattgaatc ggtttcaggc      1260
     aaagagttcg atgaaatgta ttctaatttt gtctaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page