(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE439

CP001994.PE439       Location/Qualifiers
FT   CDS_pept        complement(466833..466997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: geo:Geob_2254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35977"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X6"
FT                   /protein_id="ADE35977.1"
FT                   /translation="MKCPFCGFEFDEPDKSTCAGCGKLHSCNMQKCPNCKYEIPKETKL
FT                   EKLLRGVFK"
     atgaaatgcc cgttttgcgg attcgaattc gatgaacctg acaaatcgac gtgtgcagga        60
     tgtggcaaac tgcattcatg caatatgcag aaatgcccaa actgtaagta tgaaattccc       120
     aaagaaacaa aactggaaaa attgctaaga ggtgtattca agtga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page