(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE440

CP001994.PE440       Location/Qualifiers
FT   CDS_pept        complement(466994..469027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0448"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR006073:IPR001806:IPR011642:IPR002917:IPR
FT                   011619:IPR011640:IPR005225:IPR003373; KEGG: gur:Gura_3001
FT                   ferrous iron transport protein B; PFAM: GTP-binding protein
FT                   HSR1-related; nucleoside recognition domain protein;
FT                   Ferrous iron transport protein B domain protein; Ferrous
FT                   iron transport B domain protein; SPTR: O29993 Iron (II)
FT                   transporter (FeoB-1); TIGRFAM: ferrous iron transport
FT                   protein B; small GTP-binding protein; PFAM: Ferrous iron
FT                   transport protein B; Ferrous iron transport protein B C
FT                   terminus; Nucleoside recognition; TIGRFAM: ferrous iron
FT                   transporter FeoB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35978"
FT                   /db_xref="GOA:D5E9X7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X7"
FT                   /protein_id="ADE35978.1"
FT                   /translation="MKLPTLKTKGKCCQISETPSNGLEKIVLVGNPNVGKSVLFNHFSN
FT                   SYTIVSNYPGTTVEISKGDGTIAGKEYEIIDTPGMYSMLPITEEERVAQKYVLDEDAHV
FT                   YLHVVDAKNLRRMLPLTIQLIEADVPLILVLNMMDEAEERGVEIDTQRLAQRLGIPVVS
FT                   TVSTTGRGLKELEETIANYKPTQKHFIPNYGEEIESAIEKTVSSLNSEYRVAKRALAQL
FT                   LLQKDLIAFEKIQRKEEEPERIGLIVDDSQAEHSEPLNLKIAIKRQDNVNEIIDSVMTQ
FT                   KEDREKAAEKKTHENENSISRRIDKLLIRPITGIPILLLILYFGLYKFVGVFAAGTVVD
FT                   YLEGTLFGEQINPWVIANFNALVPYPVIQDLFVGEYGIFTQAITYAIALIMPLVGAFFI
FT                   VFSIIEDTGYLPRLAMLIDRLFKKIGLSGRAVIPMVLGFGCVTMATMVTRTLETKRERV
FT                   IASMLLALAIPCSAQLGVILGVLSFSSKALFIWAIVVFLELILIGFLASKVMSGEKPNF
FT                   FVEMPPLRLPKISNVAIKTYSRMQWYFLEVLPLFIVASVVIWIGRLIGLFDIAVKLLAY
FT                   PSQWIGLPAEAGVMFLFGFFRRDFGAAGLFDMYNAGMLTGVNIVVAAVTLTLFMPCIAQ
FT                   FMMTVKERGLKTAFAMAAFIFPSAFGVGFVVNYLLNYFGVIL"
     atgaagttac caacactaaa aacaaaaggc aaatgctgcc agatatcgga aactccttca        60
     aacggacttg aaaaaatagt gcttgtaggc aatccgaatg tcggaaaaag tgtcctcttc       120
     aaccacttct cgaacagcta taccatagtt tccaactatc ccggaaccac ggtagagatc       180
     agtaaaggag acggaacgat agcaggaaag gagtacgaga taatagatac ccccggaatg       240
     tactctatgc tgcccattac agaggaggaa agggtggccc agaaatacgt ccttgatgaa       300
     gatgcccatg tatacctcca tgtagtggat gcaaaaaatc tgaggaggat gctgcccctt       360
     acaatccagt taattgaagc agacgtaccc ctcatacttg tactcaatat gatggatgag       420
     gctgaagaaa gaggagtaga gattgatact cagagacttg cacaaaggct ggggattcca       480
     gtcgttagta cagtctcgac cactggcagg ggtttgaaag agctggaaga gactatcgcc       540
     aactacaaac ccactcaaaa gcatttcatt ccaaattacg gtgaagaaat cgaatctgca       600
     attgagaaaa cagtttcttc cctgaattct gaatatagag tagcaaaaag agcccttgca       660
     caacttctgc tccagaagga tcttattgct ttcgaaaaaa ttcaaagaaa ggaagaagaa       720
     ccggaaagga taggactaat tgttgatgac agccaagctg aacacagtga accactcaat       780
     ctgaaaatag caataaaaag gcaggataat gtcaatgaaa taatcgattc agtcatgaca       840
     cagaaggaag atagagagaa agcagccgaa aaaaagacgc atgaaaatga aaacagtata       900
     agtaggcgta ttgataaact tctgatccgg ccaattacag gcataccaat actcctccta       960
     atactctatt tcggtcttta caaatttgta ggagtatttg cagcaggaac ggtggttgat      1020
     tatctggaag gaacactttt tggagaacag atcaatccat gggttattgc taatttcaat      1080
     gcccttgttc cctatccagt cattcaggac ctgtttgtag gagaatatgg gatattcacc      1140
     caggcaatca cctatgctat cgcactgata atgcccctgg taggtgcttt cttcatagta      1200
     ttctcgataa tagaggacac aggatatctg cccaggcttg ccatgctcat tgacagacta      1260
     ttcaagaaga ttggcctcag cggaagagca gtaatcccca tggtactggg atttggctgt      1320
     gttaccatgg cgacaatggt cacacgtacc ctggaaacta aacgtgaacg agtcatagca      1380
     agcatgctgc ttgcacttgc tattccctgc tccgcacagc taggagtgat tctgggagtg      1440
     ttgtccttca gctcaaaagc attgttcata tgggcaattg tagtattttt ggaattgata      1500
     ctcataggat ttctggcatc aaaggtcatg tccggagaaa aaccaaattt ctttgtagaa      1560
     atgccacccc tgcgcctgcc taaaatatcc aatgtcgcta taaaaacata ctcaaggatg      1620
     cagtggtatt tccttgaagt gttgccactg tttattgtag ccagtgtagt gatatggatt      1680
     ggaagactca tcggtctgtt cgatattgct gtgaaactgc tggcatatcc ctcacagtgg      1740
     ataggtttgc ccgcagaggc aggggtgatg ttcctgtttg gattcttcag gagagatttt      1800
     ggtgctgccg gtcttttcga catgtataat gcaggaatgc tgaccggagt aaacattgtg      1860
     gtagctgctg ttaccctgac cctgttcatg ccctgcatag cccagttcat gatgacagta      1920
     aaggaaaggg gactaaaaac agcctttgca atggcagctt tcatattccc aagtgccttt      1980
     ggagttggtt ttgtagtcaa ttacctgctc aattatttcg gagtgatact atga            2034
//

If you have problems or comments...

PBIL Back to PBIL home page